Os06t0571800-03

Locus

Os06g0571800

Description

GATA-type zinc finger transcription factor, Cold tolerance

RAP-DB Gene Symbol Synonym(s)

OsGATA16

RAP-DB Gene Name Synonym(s)

GATA transcription factor 16

CGSNL Gene Symbol

GATA16

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 16

Oryzabase Gene Symbol Synonym(s)

OsGATA16, OsGNC, GNC

Oryzabase Gene Name Synonym(s)

GATA transcription factor 16, GATA factor 16, "GATA, NITRATE-INDUCIBLE, CARBON-METABOLISM INVOLVED"

Transcript Evidence

Inferred from literature

Protein Evidence

B9FTU8

Literature

PMID: 33982131

Note

Manual Curation

May 18, 2021

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, NHR/GATA-type (IPR013088)

Zinc finger, GATA-type (IPR000679)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Others

Oryzabase (20499)

Transcript

1782 bp

>Os06t0571800-03 GATA-type zinc finger transcription factor, Cold tolerance
TAATCGTGCTGGACCTCGCAAAATTGCCCCTCCAACCGCATCAACACTCGTCGCGCGAAG
CGTACCATCGTCTCTCTCATCTTCCTCGCGGTCTCATCCTGATCGATCTCTGCGAGTTTA
TCCAATATCTGTACTCGCAAACTAGCTAGAGAGATCTAGTTAGTAGCTAGGCAGTTGCTG
CCTCTCATGTCTACCATCTACATGAGTCAGCTCTCAGCTGCTCTCCCTCTCATGGAGGGG
GAGCACCACCATCACCACCAGGATCATCACCAAGGCCACTTCCAAGCCTTCTCCCTGCAG
CCTAAGGATCCCCCAGTCTTATTCCCCTTTGTGATCAGTAGAAGAAGCAGCAGCAGCAGC
CCTAGCGACAGCACCACTCTAAGCTATGGTTCAGACCATCACTTGACACAGCAGCAGCAG
CATCAGCATCAAGCCATGCTTGAGCCCCAAAATATGATTGGAGGATCATCCGCTGGCATC
TTTGCGACGCCGTTCCCGACCGTCAAGAGCATCCGCGACGACATGATCGAGCGGTCGCAG
TTCGATCCATACGATACCGAGAAGCTGCAGGCGAGCTGCGGGTTAGCCAAGGTCGTCGCC
GGCGGCAAGTGGAGCGCGGTGCCAGCGGCCAAGATGAAGATCACGAGGAAGATGGGTGAG
CCGTCGTCCGGTGTCACTGGcggggctgcgacgacggtggcgccgaagaagccgaggagg
aggccggcgcaggcgtacgaggatcacggccatggcggcgcCATGGGCCAAGCTTTTGGC
GTGATTAGGGTGTGCTCCGACTGCAACACCACCAAGACTCCCTTGTGGAGGAGTGGCCCG
TGCGGCCCCAAGTCGCTTTGCAACGCGTGCGGCATCAGGCAGAGGAAGGCGCGGCGGGCG
ATGATGGCCTCCGGACTACCAGCGTCCCCCAACGCCGCCGGCCCCAAGGCGGCCGCACAT
AGCGGCGCCGCTGCGGTGGCGGCTGCGCAGCCGAAGGTGAAGAAGGAGAAGAGAGCCGAC
GTCGACCGGTCGTCGCTGCCGTTCAAGAAACGGTGCAAGGTCGTCCAGGTCGAGGATCAT
CAAACGCTGCCCGCCGCCACAAACGCAGCCGCCGCAGCTGCCATGGAGGAGACGGCCGAG
TCCGCCACCGTCGCCCCGCCCCCGGCGCCGACGACGAGGGGTGGTACTCTCGTCGACAGC
ATCGGGCTCAGCTGGAGCAAGACCCATGCCGCCGCCACCGCCTCCTGCAGCTTCCGGCCG
TCACCGGTGGCTCCCGGCTTCGCGGCGGCGGTGCAGGACGAGATCACTGACGCCGCCATG
CTGCTCATGACGCTGTCCTGCGGGCTTGTCCGGAGCTGAGAAAGAAAAGCTATACTTCAT
CTCTGCATGCATCCATCGATCGATCGATTGGCACCAAGCTAGAGAGACCAATCGATGGAG
ATGGAGAGAGGTGCAGGCTTTTTGCAGCTAGTGCGTTAGCCTGTTCTTGCTCGCTCGATC
GATCGTACACTGCCCCCCAGTTGGAATGTCTCTTGGCGTCTTGTTTCCTGTTCGAGTCTT
GTGATCTCTGTTACTTTGTGCACTGTACTAGAGAGTGAGAGAGAGAGTGAGGTAGAAACA
TCAAGAGGAGATTAGAGGAGAAAGAATAATTAAGAGAAAAGTGTGAGCTAGCTAGGTAAG
ATTTACTGTACTGTGAGTTCAATTTGGAGTAAGCTTTTTTGGGCTGCTTCACGGCTAATT
ATGCCACTGGCTGCTATATATGTATGTTTGTTCTTCGTTTAA

CDS

1173 bp

>Os06t0571800-03 GATA-type zinc finger transcription factor, Cold tolerance
ATGTCTACCATCTACATGAGTCAGCTCTCAGCTGCTCTCCCTCTCATGGAGGGGGAGCAC
CACCATCACCACCAGGATCATCACCAAGGCCACTTCCAAGCCTTCTCCCTGCAGCCTAAG
GATCCCCCAGTCTTATTCCCCTTTGTGATCAGTAGAAGAAGCAGCAGCAGCAGCCCTAGC
GACAGCACCACTCTAAGCTATGGTTCAGACCATCACTTGACACAGCAGCAGCAGCATCAG
CATCAAGCCATGCTTGAGCCCCAAAATATGATTGGAGGATCATCCGCTGGCATCTTTGCG
ACGCCGTTCCCGACCGTCAAGAGCATCCGCGACGACATGATCGAGCGGTCGCAGTTCGAT
CCATACGATACCGAGAAGCTGCAGGCGAGCTGCGGGTTAGCCAAGGTCGTCGCCGGCGGC
AAGTGGAGCGCGGTGCCAGCGGCCAAGATGAAGATCACGAGGAAGATGGGTGAGCCGTCG
TCCGGTGTCACTGGcggggctgcgacgacggtggcgccgaagaagccgaggaggaggccg
gcgcaggcgtacgaggatcacggccatggcggcgcCATGGGCCAAGCTTTTGGCGTGATT
AGGGTGTGCTCCGACTGCAACACCACCAAGACTCCCTTGTGGAGGAGTGGCCCGTGCGGC
CCCAAGTCGCTTTGCAACGCGTGCGGCATCAGGCAGAGGAAGGCGCGGCGGGCGATGATG
GCCTCCGGACTACCAGCGTCCCCCAACGCCGCCGGCCCCAAGGCGGCCGCACATAGCGGC
GCCGCTGCGGTGGCGGCTGCGCAGCCGAAGGTGAAGAAGGAGAAGAGAGCCGACGTCGAC
CGGTCGTCGCTGCCGTTCAAGAAACGGTGCAAGGTCGTCCAGGTCGAGGATCATCAAACG
CTGCCCGCCGCCACAAACGCAGCCGCCGCAGCTGCCATGGAGGAGACGGCCGAGTCCGCC
ACCGTCGCCCCGCCCCCGGCGCCGACGACGAGGGGTGGTACTCTCGTCGACAGCATCGGG
CTCAGCTGGAGCAAGACCCATGCCGCCGCCACCGCCTCCTGCAGCTTCCGGCCGTCACCG
GTGGCTCCCGGCTTCGCGGCGGCGGTGCAGGACGAGATCACTGACGCCGCCATGCTGCTC
ATGACGCTGTCCTGCGGGCTTGTCCGGAGCTGA

Protein

390 aa

>Os06t0571800-03 GATA-type zinc finger transcription factor, Cold tolerance
MSTIYMSQLSAALPLMEGEHHHHHQDHHQGHFQAFSLQPKDPPVLFPFVISRRSSSSSPS
DSTTLSYGSDHHLTQQQQHQHQAMLEPQNMIGGSSAGIFATPFPTVKSIRDDMIERSQFD
PYDTEKLQASCGLAKVVAGGKWSAVPAAKMKITRKMGEPSSGVTGGAATTVAPKKPRRRP
AQAYEDHGHGGAMGQAFGVIRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKARRAMM
ASGLPASPNAAGPKAAAHSGAAAVAAAQPKVKKEKRADVDRSSLPFKKRCKVVQVEDHQT
LPAATNAAAAAAMEETAESATVAPPPAPTTRGGTLVDSIGLSWSKTHAAATASCSFRPSP
VAPGFAAAVQDEITDAAMLLMTLSCGLVRS*

5'UTR

chr06:22155053..22155238 (+ strand) : 186 bp

CDS

chr06:22155239..22155505 (+ strand) : 267 bp

chr06:22155629..22156027 (+ strand) : 399 bp

chr06:22156132..22156638 (+ strand) : 507 bp

3'UTR

chr06:22156639..22157061 (+ strand) : 423 bp

FASTA

>Os06t0571800-03 class=Sequence position=chr06:22155053..22157061 (+ strand)
TAATCGTGCT GGACCTCGCA AAATTGCCCC TCCAACCGCA TCAACACTCG TCGCGCGAAG CGTACCATCG TCTCTCTCAT
CTTCCTCGCG GTCTCATCCT GATCGATCTC TGCGAGTTTA TCCAATATCT GTACTCGCAA ACTAGCTAGA GAGATCTAGT
TAGTAGCTAG GCAGTTGCTG CCTCTCATGT CTACCATCTA CATGAGTCAG CTCTCAGCTG CTCTCCCTCT CATGGAGGGG
GAGCACCACC ATCACCACCA GGATCATCAC CAAGGCCACT TCCAAGCCTT CTCCCTGCAG CCTAAGGATC CCCCAGTCTT
ATTCCCCTTT GTGATCAGTA GAAGAAGCAG CAGCAGCAGC CCTAGCGACA GCACCACTCT AAGCTATGGT TCAGACCATC
ACTTGACACA GCAGCAGCAG CATCAGCATC AAGCCATGCT TGAGCCCCAA AATGTAAGCT CTACCGTCTA ATCTGTACCT
ATATGTAGCT ATAGCTAGGG GTTCAAGTCT TAATCATGTG TTGATTTGTC AAATTGTTTG TTTGACATGT TAATTCTTCT
GCTGTTAAAT CATCAGATGA TTGGAGGATC ATCCGCTGGC ATCTTTGCGA CGCCGTTCCC GACCGTCAAG AGCATCCGCG
ACGACATGAT CGAGCGGTCG CAGTTCGATC CATACGATAC CGAGAAGCTG CAGGCGAGCT GCGGGTTAGC CAAGGTCGTC
GCCGGCGGCA AGTGGAGCGC GGTGCCAGCG GCCAAGATGA AGATCACGAG GAAGATGGGT GAGCCGTCGT CCGGTGTCAC
TGGcggggct gcgacgacgg tggcgccgaa gaagccgagg aggaggccgg cgcaggcgta cgaggatcac ggccatggcg
gcgcCATGGG CCAAGCTTTT GGCGTGATTA GGGTGTGCTC CGACTGCAAC ACCACCAAGA CTCCCTTGTG GAGGAGTGGC
CCGTGCGGCC CCAAGGTACT TATATACCTC TTCGTCTCAC TCATGGCCAT GGCGCCATGG ATGCTTTTGC TTGCGTATAC
TGCAGCTGTG TCTCATTTCA TGGCTGTTCC ATGGTGCAGT CGCTTTGCAA CGCGTGCGGC ATCAGGCAGA GGAAGGCGCG
GCGGGCGATG ATGGCCTCCG GACTACCAGC GTCCCCCAAC GCCGCCGGCC CCAAGGCGGC CGCACATAGC GGCGCCGCTG
CGGTGGCGGC TGCGCAGCCG AAGGTGAAGA AGGAGAAGAG AGCCGACGTC GACCGGTCGT CGCTGCCGTT CAAGAAACGG
TGCAAGGTCG TCCAGGTCGA GGATCATCAA ACGCTGCCCG CCGCCACAAA CGCAGCCGCC GCAGCTGCCA TGGAGGAGAC
GGCCGAGTCC GCCACCGTCG CCCCGCCCCC GGCGCCGACG ACGAGGGGTG GTACTCTCGT CGACAGCATC GGGCTCAGCT
GGAGCAAGAC CCATGCCGCC GCCACCGCCT CCTGCAGCTT CCGGCCGTCA CCGGTGGCTC CCGGCTTCGC GGCGGCGGTG
CAGGACGAGA TCACTGACGC CGCCATGCTG CTCATGACGC TGTCCTGCGG GCTTGTCCGG AGCTGAGAAA GAAAAGCTAT
ACTTCATCTC TGCATGCATC CATCGATCGA TCGATTGGCA CCAAGCTAGA GAGACCAATC GATGGAGATG GAGAGAGGTG
CAGGCTTTTT GCAGCTAGTG CGTTAGCCTG TTCTTGCTCG CTCGATCGAT CGTACACTGC CCCCCAGTTG GAATGTCTCT
TGGCGTCTTG TTTCCTGTTC GAGTCTTGTG ATCTCTGTTA CTTTGTGCAC TGTACTAGAG AGTGAGAGAG AGAGTGAGGT
AGAAACATCA AGAGGAGATT AGAGGAGAAA GAATAATTAA GAGAAAAGTG TGAGCTAGCT AGGTAAGATT TACTGTACTG
TGAGTTCAAT TTGGAGTAAG CTTTTTTGGG CTGCTTCACG GCTAATTATG CCACTGGCTG CTATATATGT ATGTTTGTTC
TTCGTTTAA

Locus: Os06g0571800

Loading...

Locus: Os06g0571800

Loading...