Os06t0573600-01

Locus

Os06g0573600

Description

Beta-galactosidase

RAP-DB Gene Symbol Synonym(s)

OsBGal2

RAP-DB Gene Name Synonym(s)

beta-galactosidase 2, β-galactosidase 2

CGSNL Gene Symbol

BGAL2

CGSNL Gene Name

BETA-GALACTOSIDASE 2

Oryzabase Gene Symbol Synonym(s)

OsBgal2, OsBGal2

Oryzabase Gene Name Synonym(s)

Beta-galactosidase 9, Lactase 9

Transcript Evidence

AK102756

Protein Evidence

Q5Z7L0

Literature

DOI: 10.1016/j.plantsci.2007.04.009

Note

Manual Curation

September 14, 2021

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase superfamily (IPR017853)

Galactose-binding-like domain superfamily (IPR008979)

Glycoside hydrolase, family 35 (IPR001944)

Glycoside hydrolase 35, catalytic domain (IPR031330)

Beta-galactosidase, beta-sandwich domain (IPR041392)

Glycoside hydrolase, family 35, conserved site (IPR019801)

Full-length cDNA

J033107B05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0573600-01)

RiceXPro (AK102756)

Others

Oryzabase (8290)

KEGG (Os06t0573600-01 (EC:3.2.1.23))

Transcript

2846 bp

>Os06t0573600-01 Beta-galactosidase
GCTTCTTCTGCTTCACGCTTTCACCATTTCACCCCTCACGCCTTGCTCTCTCTCTCTTCC
CTCTCCAATGGTGAACAGAATGGCGGTAATCCAAAAGCGAGGGAATACAATCAAACCAAG
AAATTAAATTTAAATGAGAAGAAAAAATGCACAGATAATATAAATTGAGACACCGAAATC
AAGAACTCGTATAAAAAGCCCACCACCACCACCGCTTCTCTCCTCTCCCACTCCTCTCCT
TCTCCTTCTCCTTCTTCTTCCTCCATTGGCATCTCCAAGAAACCCAAGCCTTTCTACGTG
CTTCGAGCTCGGCCACCGGCCGGCGGACGCGCGCGCGCCAGCCACCATGTCCGGCGGCGC
CGTCGCCTTCCTCCTGCTCGTCGCCGCCGCCGCCGTGGCCAATGCCGCCGTCACCTACGA
CCACAGGTCGCTCACCATCAATGGCCAGCGCCGCATCCTCATCTCCGGCTCCATCCACTA
CCCTCGCAGCACCCCCGAGATGTGGCCGGACCTGATCCAGAAGGCCAAGGACGGCGGCCT
CGACGTGATCCAGACCTACGTCTTCTGGAACGGCCACGAGCCAGTGCAGGGACAGTACTA
CTTCAGCGACAGGTACGACCTGGTGAGGTTCGTGAAGCTGGTGAAGCAGGCAGGGCTCTA
TGTCAACCTCCGCATCGGCCCCTACGTCTGCGCCGAATGGAACTACGGTGGGTTTCCTGT
CTGGCTCAAGTACGTCCCGGGCATCAGCTTCAGGACTGACAATGGTCCATTCAAGGCGGC
GATGCAGACGTTCGTGGAGAAGATCGTGTCGATGATGAAATCGGAAGGGCTGTTCGAGTG
GCAGGGCGGCCCGATCATCCTCGCCCAGGTAGAGAACGAGTACGGGCCGATGGAGTCGGT
GATGGGCAGCGGCGCGAAGTCGTACGTCGACTGGGCGGCGAAGATGGCCGTCGCCACCAA
CGCCGGCGTGCCCTGGATCATGTGCAAGCAGGACGACGCCCCTGACCCCGTGATCAACAC
CTGCAACGGATTCTACTGCGACGACTTCACCCCCAACTCCAAGAACAAGCCTTCCATGTG
GACAGAGGCCTGGAGCGGCTGGTTTACGGCTTTCGGTGGCACGGTGCCGCAGCGGCCAGT
GGAGGATCTGGCGTTCGCCGTGGCGAGGTTCATCCAGAAGGGCGGCTCCTTCATCAACTA
CTACATGTACCATGGCGGCACCAACTTTGACCGGACAGCTGGCGGCCCGTTCATCGCGAC
GAGCTACGATTATGATGCGCCGATCGATGAATACGGTCTGCTTCGGCAGCCCAAATGGGG
TCACCTGACGAACCTTCACAAGGCCATCAAGCAGGCCGAGACGGCGCTCGTTGCCGGCGA
CCCGACCGTCCAGAACATCGGCAACTACGAGAAGGCATACGTGTTCAGGTCGAGCAGCGG
CGACTGCGCGGCGTTCCTGTCCAACTTCCACACGAGCGCGGCGGCGAGGGTGGCGTTCAA
CGGGCGGCGGTACGACCTCCCGGCGTGGTCCATCAGCGTGCTGCCGGACTGCAGGACCGC
CGTGTACAACACCGCGACGGTGACGGCGGCGTCGTCGCCGGCGAAGATGAACCCGGCGGG
CGGGTTCACCTGGCAGTCGTACGGCGAGGCCACCAACTCGCTGGACGAGACGGCCTTCAC
CAAGGACGGCCTCGTCGAGCAGCTCAGCATGACGTGGGACAAGTCCGACTACCTGTGGTA
CACCACCTACGTCAACATCGACTCCGGCGAGCAGTTCTTGAAGTCCGGCCAGTGGCCGCA
GCTGACCGTCTACTCCGCCGGGCACAGCGTGCAGGTGTTCGTCAACGGGCAATACTTCGG
CAATGCGTATGGTGGCTACGACGGGCCGAAGCTGACGTACAGTGGGTACGTCAAGATGTG
GCAGGGCAGTAACAAGATCTCCATCCTCAGCTCCGCCGTCGGCCTCCCGAACGTCGGCAC
GCATTATGAGACGTGGAACATCGGCGTGCTCGGCCCGGTGACGCTGTCCGGCCTCAACGA
GGGGAAGAGAGACCTCAGCAAACAGAAATGGACATACCAGATTGGCCTGAAGGGGGAGAA
GCTGGGGGTGCACTCCGTCAGCGGGAGCTCCTCCGTGGAGTGGGGCGGCGCCGCCGGCAA
GCAGCCGGTGACGTGGCACAGGGCCTACTTCAACGCGCCGGCCGGCGGCGCGCCGGTGGC
GCTGGACCTCGGCAGCATGGGGAAGGGCCAGGCGTGGGTGAACGGCCACCTCATCGGCCG
CTACTGGTCCTACAAGGCCTCCGGCAACTGCGGCGGCTGCAGCTACGCCGGCACCTACTC
CGAGAAGAAGTGCCAGGCCAACTGCGGCGACGCCTCCCAGAGATGGTACCATGTCCCAAG
ATCATGGCTGAATCCTAGCGGGAACCTGGTGGTGCTGCTGGAAGAGTTCGGCGGCGACTT
GTCCGGGGTCACGTTGATGACGAGGACGACATGAACAGGAGGAAGAATTGAAGTGGAGAT
GATTTGAATTGTGGATAATTTAGCAGGGGGAATTGCAGAATTGGGGATTTGGGAGCGAAG
GAAAGTGGGGGCGTATAGCAATTATCTATACATACGGCGTAGATACGGATACGGCTGGGT
ATACGTACATACGTATACGTATATGAACTGGTAGAGTACTGTTATTTATTGATGGCTGCC
GCGCTGGCCGGCCGTACGCCGGAGCGGCTGCAGGAACTGCGGCTCCGGTCACGGCTGCCG
GCGGCCGGTGTACGGTCGCCGTCGATTATTTATTATTTTACTAGTTATTTATTCTGAGCC
GTGGATGATGGCTTTGAGATCAGTGC

CDS

2148 bp

>Os06t0573600-01 Beta-galactosidase
ATGTCCGGCGGCGCCGTCGCCTTCCTCCTGCTCGTCGCCGCCGCCGCCGTGGCCAATGCC
GCCGTCACCTACGACCACAGGTCGCTCACCATCAATGGCCAGCGCCGCATCCTCATCTCC
GGCTCCATCCACTACCCTCGCAGCACCCCCGAGATGTGGCCGGACCTGATCCAGAAGGCC
AAGGACGGCGGCCTCGACGTGATCCAGACCTACGTCTTCTGGAACGGCCACGAGCCAGTG
CAGGGACAGTACTACTTCAGCGACAGGTACGACCTGGTGAGGTTCGTGAAGCTGGTGAAG
CAGGCAGGGCTCTATGTCAACCTCCGCATCGGCCCCTACGTCTGCGCCGAATGGAACTAC
GGTGGGTTTCCTGTCTGGCTCAAGTACGTCCCGGGCATCAGCTTCAGGACTGACAATGGT
CCATTCAAGGCGGCGATGCAGACGTTCGTGGAGAAGATCGTGTCGATGATGAAATCGGAA
GGGCTGTTCGAGTGGCAGGGCGGCCCGATCATCCTCGCCCAGGTAGAGAACGAGTACGGG
CCGATGGAGTCGGTGATGGGCAGCGGCGCGAAGTCGTACGTCGACTGGGCGGCGAAGATG
GCCGTCGCCACCAACGCCGGCGTGCCCTGGATCATGTGCAAGCAGGACGACGCCCCTGAC
CCCGTGATCAACACCTGCAACGGATTCTACTGCGACGACTTCACCCCCAACTCCAAGAAC
AAGCCTTCCATGTGGACAGAGGCCTGGAGCGGCTGGTTTACGGCTTTCGGTGGCACGGTG
CCGCAGCGGCCAGTGGAGGATCTGGCGTTCGCCGTGGCGAGGTTCATCCAGAAGGGCGGC
TCCTTCATCAACTACTACATGTACCATGGCGGCACCAACTTTGACCGGACAGCTGGCGGC
CCGTTCATCGCGACGAGCTACGATTATGATGCGCCGATCGATGAATACGGTCTGCTTCGG
CAGCCCAAATGGGGTCACCTGACGAACCTTCACAAGGCCATCAAGCAGGCCGAGACGGCG
CTCGTTGCCGGCGACCCGACCGTCCAGAACATCGGCAACTACGAGAAGGCATACGTGTTC
AGGTCGAGCAGCGGCGACTGCGCGGCGTTCCTGTCCAACTTCCACACGAGCGCGGCGGCG
AGGGTGGCGTTCAACGGGCGGCGGTACGACCTCCCGGCGTGGTCCATCAGCGTGCTGCCG
GACTGCAGGACCGCCGTGTACAACACCGCGACGGTGACGGCGGCGTCGTCGCCGGCGAAG
ATGAACCCGGCGGGCGGGTTCACCTGGCAGTCGTACGGCGAGGCCACCAACTCGCTGGAC
GAGACGGCCTTCACCAAGGACGGCCTCGTCGAGCAGCTCAGCATGACGTGGGACAAGTCC
GACTACCTGTGGTACACCACCTACGTCAACATCGACTCCGGCGAGCAGTTCTTGAAGTCC
GGCCAGTGGCCGCAGCTGACCGTCTACTCCGCCGGGCACAGCGTGCAGGTGTTCGTCAAC
GGGCAATACTTCGGCAATGCGTATGGTGGCTACGACGGGCCGAAGCTGACGTACAGTGGG
TACGTCAAGATGTGGCAGGGCAGTAACAAGATCTCCATCCTCAGCTCCGCCGTCGGCCTC
CCGAACGTCGGCACGCATTATGAGACGTGGAACATCGGCGTGCTCGGCCCGGTGACGCTG
TCCGGCCTCAACGAGGGGAAGAGAGACCTCAGCAAACAGAAATGGACATACCAGATTGGC
CTGAAGGGGGAGAAGCTGGGGGTGCACTCCGTCAGCGGGAGCTCCTCCGTGGAGTGGGGC
GGCGCCGCCGGCAAGCAGCCGGTGACGTGGCACAGGGCCTACTTCAACGCGCCGGCCGGC
GGCGCGCCGGTGGCGCTGGACCTCGGCAGCATGGGGAAGGGCCAGGCGTGGGTGAACGGC
CACCTCATCGGCCGCTACTGGTCCTACAAGGCCTCCGGCAACTGCGGCGGCTGCAGCTAC
GCCGGCACCTACTCCGAGAAGAAGTGCCAGGCCAACTGCGGCGACGCCTCCCAGAGATGG
TACCATGTCCCAAGATCATGGCTGAATCCTAGCGGGAACCTGGTGGTGCTGCTGGAAGAG
TTCGGCGGCGACTTGTCCGGGGTCACGTTGATGACGAGGACGACATGA

Protein

715 aa

>Os06t0573600-01 Beta-galactosidase
MSGGAVAFLLLVAAAAVANAAVTYDHRSLTINGQRRILISGSIHYPRSTPEMWPDLIQKA
KDGGLDVIQTYVFWNGHEPVQGQYYFSDRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNY
GGFPVWLKYVPGISFRTDNGPFKAAMQTFVEKIVSMMKSEGLFEWQGGPIILAQVENEYG
PMESVMGSGAKSYVDWAAKMAVATNAGVPWIMCKQDDAPDPVINTCNGFYCDDFTPNSKN
KPSMWTEAWSGWFTAFGGTVPQRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFDRTAGG
PFIATSYDYDAPIDEYGLLRQPKWGHLTNLHKAIKQAETALVAGDPTVQNIGNYEKAYVF
RSSSGDCAAFLSNFHTSAAARVAFNGRRYDLPAWSISVLPDCRTAVYNTATVTAASSPAK
MNPAGGFTWQSYGEATNSLDETAFTKDGLVEQLSMTWDKSDYLWYTTYVNIDSGEQFLKS
GQWPQLTVYSAGHSVQVFVNGQYFGNAYGGYDGPKLTYSGYVKMWQGSNKISILSSAVGL
PNVGTHYETWNIGVLGPVTLSGLNEGKRDLSKQKWTYQIGLKGEKLGVHSVSGSSSVEWG
GAAGKQPVTWHRAYFNAPAGGAPVALDLGSMGKGQAWVNGHLIGRYWSYKASGNCGGCSY
AGTYSEKKCQANCGDASQRWYHVPRSWLNPSGNLVVLLEEFGGDLSGVTLMTRTT*

5'UTR

chr06:22245386..22245731 (+ strand) : 346 bp

CDS

chr06:22245732..22245884 (+ strand) : 153 bp

chr06:22245971..22246066 (+ strand) : 96 bp

chr06:22246182..22246294 (+ strand) : 113 bp

chr06:22246410..22246476 (+ strand) : 67 bp

chr06:22246561..22246653 (+ strand) : 93 bp

chr06:22246788..22246931 (+ strand) : 144 bp

chr06:22247513..22247601 (+ strand) : 89 bp

chr06:22247730..22247835 (+ strand) : 106 bp

chr06:22247939..22248026 (+ strand) : 88 bp

chr06:22248124..22248242 (+ strand) : 119 bp

chr06:22248733..22249067 (+ strand) : 335 bp

chr06:22249644..22249753 (+ strand) : 110 bp

chr06:22249890..22249999 (+ strand) : 110 bp

chr06:22250123..22250233 (+ strand) : 111 bp

chr06:22250690..22250994 (+ strand) : 305 bp

chr06:22251087..22251195 (+ strand) : 109 bp

3'UTR

chr06:22251196..22251547 (+ strand) : 352 bp

FASTA

>Os06t0573600-01 class=Sequence position=chr06:22245386..22251547 (+ strand)
GCTTCTTCTG CTTCACGCTT TCACCATTTC ACCCCTCACG CCTTGCTCTC TCTCTCTTCC CTCTCCAATG GTGAACAGAA
TGGCGGTAAT CCAAAAGCGA GGGAATACAA TCAAACCAAG AAATTAAATT TAAATGAGAA GAAAAAATGC ACAGATAATA
TAAATTGAGA CACCGAAATC AAGAACTCGT ATAAAAAGCC CACCACCACC ACCGCTTCTC TCCTCTCCCA CTCCTCTCCT
TCTCCTTCTC CTTCTTCTTC CTCCATTGGC ATCTCCAAGA AACCCAAGCC TTTCTACGTG CTTCGAGCTC GGCCACCGGC
CGGCGGACGC GCGCGCGCCA GCCACCATGT CCGGCGGCGC CGTCGCCTTC CTCCTGCTCG TCGCCGCCGC CGCCGTGGCC
AATGCCGCCG TCACCTACGA CCACAGGTCG CTCACCATCA ATGGCCAGCG CCGCATCCTC ATCTCCGGCT CCATCCACTA
CCCTCGCAGC ACCCCCGAGG TACGTATCCT CTCCAAGCTA CCCAAGCAGT TCATCGCTCA GAGCTCGCTC GCCTGACCAA
ATTCCTCCCG TTTCCATGGC GGCAGATGTG GCCGGACCTG ATCCAGAAGG CCAAGGACGG CGGCCTCGAC GTGATCCAGA
CCTACGTCTT CTGGAACGGC CACGAGCCAG TGCAGGGACA GGTATGTAAT ATGTTCTTGC AAACTGATGA AAGTCTGAAA
CCAACACAAG AAAATGGAGA AAGAAAAGGT TAACTGAAAC TGTTCGATCG CCATGGATGG ATGGATTCCA TGGCAGTACT
ACTTCAGCGA CAGGTACGAC CTGGTGAGGT TCGTGAAGCT GGTGAAGCAG GCAGGGCTCT ATGTCAACCT CCGCATCGGC
CCCTACGTCT GCGCCGAATG GAACTACGGG TGAGAAATCT GAATTCCGAA CGAACCCAGC AGCAGCAGCA GCATTCGTCG
AAATTCAGAG CTTCTTCTTT TTTTGGATTT CTGACAAATT TTGTTTCGGT TTTGGATTTC GCAGTGGGTT TCCTGTCTGG
CTCAAGTACG TCCCGGGCAT CAGCTTCAGG ACTGACAATG GTCCATTCAA GGTAATATTG GTGACAAATT AACAGAGAAA
ATTTGGATGC TCTGTTTTAC TCTGTTTTTT TTAAAAAAAT AAATTCGATA TGCAGGCGGC GATGCAGACG TTCGTGGAGA
AGATCGTGTC GATGATGAAA TCGGAAGGGC TGTTCGAGTG GCAGGGCGGC CCGATCATCC TCGCCCAGGT AATCAGCCAA
AAAAGAACAG TTCAATCTTT GATTTTCGTT CCAGCTCAGT GACCATGGGT AATTGATCGC CGGTGATCAC CGGAACTTCT
TGATTTGAGA AAATGAGAGA TGATCGGTCC GCGCATTGGC AGGTAGAGAA CGAGTACGGG CCGATGGAGT CGGTGATGGG
CAGCGGCGCG AAGTCGTACG TCGACTGGGC GGCGAAGATG GCCGTCGCCA CCAACGCCGG CGTGCCCTGG ATCATGTGCA
AGCAGGACGA CGCCCCTGAC CCCGTGGTAA TTTTTAACTG TCACTTTCCT CGTCTCTTTT TTTTTTTACT TCTCATTTCT
CACTGCAATT GTGTCAAAGA AAAACTGGAG TTTTTACAAA AATGTAACTA AGTTGAGTGA CTTTCTGGTC CTTGGTACCA
CTTTTAACTT TTTAGGGTAC ATAATTTTAT CATTCTTAAG TAAGTAAAGG GAGATACTTA TCTCGATGTA TTAAAATTTT
GATAATTACA ATTACTTTTC TTACGAAAGA TAAAATTTCT CTAACTTTTA AGGGTACCTC TTTGTACCGT CTTAATAAAC
AGTAAAAATT TCATTTTTTA AGTTGGGTTA AAAAACTTAA AATAGCTAAT AAATTTGCAT TAGCCACTCC ACTTTGCTGG
CGCCTAGCCC ATATGCTTTC GTTAGGACAT CACTACCAGC AGCATTCCTT TCCAGCAAGG CTGCCAACTT TGCTTCTTGG
TGCCAAACAA TTATACATGC CCTGCAATTT GTGCTACACT TTATTTCCAA AAAAAGAAAT ATCTTTTTTG AACATATTCT
TTTTATATCT TTTGTTAATT CTTGCCTTGC GCCATGGATG GCCACAGATC AACACCTGCA ACGGATTCTA CTGCGACGAC
TTCACCCCCA ACTCCAAGAA CAAGCCTTCC ATGTGGACAG AGGCCTGGAG CGGCTGGTAA TAATCCAATC AAACTAAACT
GAACTAAAAC TGAATTCATG GATCAAAATC TTTAAAATAA CAGAATCCGA ATCGTAATCT CAAATACGAA AAAAGAATAT
GATCATTTTT GTTTTGTGTT TAAGGTTTAC GGCTTTCGGT GGCACGGTGC CGCAGCGGCC AGTGGAGGAT CTGGCGTTCG
CCGTGGCGAG GTTCATCCAG AAGGGCGGCT CCTTCATCAA CTACTACATG GTCAGTGCAG TGCAGCACCT TACCTGAACC
CACATGGCTC TCACATTTTG GTCACACCAG TTGTTGACTT GTTTGATGTG CAAACATCAT GTGTTATGTT CAGTACCATG
GCGGCACCAA CTTTGACCGG ACAGCTGGCG GCCCGTTCAT CGCGACGAGC TACGATTATG ATGCGCCGAT CGATGAATAC
GGTAGCAGTT TGTTGCGCAT TTGCGTGAGA TTTCAGCTGT ATTTTCAGTT TTGTCTGAAT TTGTGGACGT CTGAAGAGTT
GTGTGTTCTG TGTTTCAGGT CTGCTTCGGC AGCCCAAATG GGGTCACCTG ACGAACCTTC ACAAGGCCAT CAAGCAGGCC
GAGACGGCGC TCGTTGCCGG CGACCCGACC GTCCAGAACA TCGGCAACTA CGAGAAGGTC CATCTCATCA CAATTTTTTT
CTGCAAAATT TCATACTTAA CCAGCATTTT ACCGTACTTA GGAAGTATTG CGAGCTACCA TATTTTCTAA TATAAATTTT
GGTAACTCTC AGTACCTCCA ATATTATAAG GTACCAAAAC TTGTATTAAA AATTTTGGTA ATTCTTGATA CTTCCCCGCT
TTAGATTATA AGTCATTATG ACtttggtca aagtcaaata gctctaagtt tgactaagtt tgtagacaaa tataataata
tttacaacac caaattagtt ttattaaatt aataattaaa tatattttta taatatattt atcttaggtt gaaaatggta
ctactttttt tctaccaact taattaaatt tggaggagtA TAGCGACTCA TAATCTGAAG CGGAGGGAGT ACATATTAAG
AACCGTAAAA TTTCTTTAGC CTGCAAGTTC ATGGCCGTGA TCATTCTTTT CCTGCATTCT TTTTCAGGCA TACGTGTTCA
GGTCGAGCAG CGGCGACTGC GCGGCGTTCC TGTCCAACTT CCACACGAGC GCGGCGGCGA GGGTGGCGTT CAACGGGCGG
CGGTACGACC TCCCGGCGTG GTCCATCAGC GTGCTGCCGG ACTGCAGGAC CGCCGTGTAC AACACCGCGA CGGTGACGGC
GGCGTCGTCG CCGGCGAAGA TGAACCCGGC GGGCGGGTTC ACCTGGCAGT CGTACGGCGA GGCCACCAAC TCGCTGGACG
AGACGGCCTT CACCAAGGAC GGCCTCGTCG AGCAGCTCAG CATGACGTGG GACAAGTCCG ACTACCTGTG GTACACCACC
TAGTAAGTGA TCCGATGCCA ACCAAACCAT CTCCGATCAG GTCCTGACCT CTGAAGATCg ggtaatttta ccattcttga
taagatacct agaggtaata tatttttatc ttaggtacaa agtatcttaa ggcaccagaa aatttagtgc agaacttagg
tacctcgagg tactttctaa aggatagtaa aatttctcTA TTTTCTAGTG TAAAATTTGA TATCTCTAGA tactccatcc
gtttcaaaat gtttgacacc gttgactttt tagtatgtgt ttgaccattc gtcttattca aaaaatttaa gtaattattt
attcttttca tatcatttga ttcattgtta aatatatttt catgtacaca tatagtttta catattttat aaattttttt
aataagacga ataatcaaac acgtgttaaa aagtcaacag tgtcaaacat tttagaacgg agggagtaCT ATAAGTAACT
TAAAGTACTA AAAAATTTTA GTGTAAAATT TTGGTACCTC AAGTGACTAT AAAATTCCTC TTGAATATTA CTTGCTAATT
AATTGTGTGT GTTGGCAGCG TCAACATCGA CTCCGGCGAG CAGTTCTTGA AGTCCGGCCA GTGGCCGCAG CTGACCGTCT
ACTCCGCCGG GCACAGCGTG CAGGTGTTCG TCAACGGGCA ATACTTCGGT AACTCTCACT GAAATTTCTT CTTGATGATG
ATGATGATGA TGATCAGACA TTCAGACAAA TTAACCAACA TTGATCTTGA GATCGGTTCA CTGATGATTC ACTGATGAAT
GAATGAATTT CGATGGTGTC GCAGGCAATG CGTATGGTGG CTACGACGGG CCGAAGCTGA CGTACAGTGG GTACGTCAAG
ATGTGGCAGG GCAGTAACAA GATCTCCATC CTCAGCTCCG CCGTCGGCCT CCCGGTGAGC TCATCTCATC GATCAGTCAT
GATATTCAGA TGATTCAAGA TTTGTCATTC AGATTTCAGA CTTTTCATGT TCAGAATTCA GATTATAATT TTTCAATCTT
GGCCGTGATT TGTGCAGAAC GTCGGCACGC ATTATGAGAC GTGGAACATC GGCGTGCTCG GCCCGGTGAC GCTGTCCGGC
CTCAACGAGG GGAAGAGAGA CCTCAGCAAA CAGAAATGGA CATACCAGGT ATAGTCCTAT ACTTCCCTcg ttccacaatg
caagtcattt tagcatttcc cacattcata ttgatgctaa tgaatgtgag aaatgctaga atgagttaca ttgtgaaacg
gagggagtaC TACTTTACTA ATCACGGTGG TCTTTACCGA TAGTATTTTT TATTATCACA GTAAAAATAA TCTCAACCAC
TAATTTATGA GTTTTGCTAT CAGTAAAAAA AAATTACTAC AAGTAGTTAA TATgatggga tttgcttcgg tccaataaaa
agtatgtcga ggtaccagta ccttacggta ctaaattgtt tccgattatt aggtctaaca atgtccatcc tacttaacta
gatccaatga tcagaaacTA ATATGATAGA AAAAATACAT ATGATTTATT AGATTAGAAG AAATGTATAA ACTGATATCA
TCTCTGCTGC ATCTATATGC TTAGATTGGC CTGAAGGGGG AGAAGCTGGG GGTGCACTCC GTCAGCGGGA GCTCCTCCGT
GGAGTGGGGC GGCGCCGCCG GCAAGCAGCC GGTGACGTGG CACAGGGCCT ACTTCAACGC GCCGGCCGGC GGCGCGCCGG
TGGCGCTGGA CCTCGGCAGC ATGGGGAAGG GCCAGGCGTG GGTGAACGGC CACCTCATCG GCCGCTACTG GTCCTACAAG
GCCTCCGGCA ACTGCGGCGG CTGCAGCTAC GCCGGCACCT ACTCCGAGAA GAAGTGCCAG GCCAACTGCG GCGACGCCTC
CCAGAGATGG TAAATTATTA AATAAATTTA CTCAAAACGG TTAAATTTTG AGCTGGATTT GATCGAATTT CTGTTCTTGT
TTGCCTGGAA ATTTTAATCA GGTACCATGT CCCAAGATCA TGGCTGAATC CTAGCGGGAA CCTGGTGGTG CTGCTGGAAG
AGTTCGGCGG CGACTTGTCC GGGGTCACGT TGATGACGAG GACGACATGA ACAGGAGGAA GAATTGAAGT GGAGATGATT
TGAATTGTGG ATAATTTAGC AGGGGGAATT GCAGAATTGG GGATTTGGGA GCGAAGGAAA GTGGGGGCGT ATAGCAATTA
TCTATACATA CGGCGTAGAT ACGGATACGG CTGGGTATAC GTACATACGT ATACGTATAT GAACTGGTAG AGTACTGTTA
TTTATTGATG GCTGCCGCGC TGGCCGGCCG TACGCCGGAG CGGCTGCAGG AACTGCGGCT CCGGTCACGG CTGCCGGCGG
CCGGTGTACG GTCGCCGTCG ATTATTTATT ATTTTACTAG TTATTTATTC TGAGCCGTGG ATGATGGCTT TGAGATCAGT
GC

Locus: Os06g0573600

Loading...

Locus: Os06g0573600

Loading...