Os06t0573600-02

Locus

Os06g0573600

Description

Similar to Beta-galactosidase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BGAL2

CGSNL Gene Name

BETA-GALACTOSIDASE 2

Oryzabase Gene Symbol Synonym(s)

OsBgal2, OsBGal2

Oryzabase Gene Name Synonym(s)

Beta-galactosidase 9, Lactase 9

Transcript Evidence

AK105619 (DDBJ, Best hit)

Protein Evidence

A2YEA5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase, family 35 (IPR001944)

Galactose-binding domain-like (IPR008979)

Full-length cDNA

001-200-C02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0573600-02)

RiceXPro (AK105619)

Others

Oryzabase (8290)

KEGG (Os06t0573600-02)

Transcript

1695 bp

>Os06t0573600-02 Similar to Beta-galactosidase.
CCTGACGAACCTTCACAAGGCCATCAAGCAGGCCGAGACGGCGCTCGTTGCCGGCGACCC
GACCGTCCAGAACATCGGCAACTACGAGAAGGCATACGTGTTCAGGTCGAGCAGCGGCGA
CTGCGCGGCGTTCCTGTCCAACTTCCACACGAGCGCGGCGGCGAGGGTGGCGTTCAACGG
GCGGCGGTACGACCTCCCGGCGTGGTCCATCAGCGTGCTGCCGGACTGCAGGACCGCCGT
GTACAACACCGCGACGGTGACGGCGGCGTCGTCGCCGGCGAAGATGAACCCGGCGGGCGG
GTTCACCTGGCAGTCGTACGGCGAGGCCACCAACTCGCTGGACGAGACGGCCTTCACCAA
GGACGGCCTCGTCGAGCAGCTCAGCATGACGTGGGACAAGTCCGACTACCTGTGGTACAC
CACCTACGTCAACATCGACTCCGGCGAGCAGTTCTTGAAGTCCGGCCAGTGGCCGCAGCT
GACCGTCTACTCCGCCGGGCACAGCGTGCAGGTGTTCGTCAACGGGCAATACTTCGGCAA
TGCGTATGGTGGCTACGACGGGCCGAAGCTGACGTACAGTGGGTACGTCAAGATGTGGCA
GGGCAGTAACAAGATCTCCATCCTCAGCTCCGCCGTCGGCCTCCCGAACGTCGGCACGCA
TTATGAGACGTGGAACATCGGCGTGCTCGGCCCGGTGACGCTGTCCGGCCTCAACGAGGG
GAAGAGAGACCTCAGCAAACAGAAATGGACATACCAGATTGGCCTGAAGGGGGAGAAGCT
GGGGGTGCACTCCGTCAGCGGGAGCTCCTCCGTGGAGTGGGGCGGCGCCGCCGGCAAGCA
GCCGGTGACGTGGCACAGGGCCTACTTCAACGCGCCGGCCGGCGGCGCGCCGGTGGCGCT
GGACCTCGGCAGCATGGGGAAGGGCCAGGCGTGGGTGAACGGCCACCTCATCGGCCGCTA
CTGGTCCTACAAGGCCTCCGGCAACTGCGGCGGCTGCAGCTACGCCGGCACCTACTCCGA
GAAGAAGTGCCAGGCCAACTGCGGCGACGCCTCCCAGAGATGGTACCATGTCCCAAGATC
ATGGCTGAATCCTAGCGGGAACCTGGTGGTGCTGCTGGAAGAGTTCGGCGGCGACTTGTC
CGGGGTCACGTTGATGACGAGGACGACATGAACAGGAGGAAGAATTGAAGTGGAGATGAT
TTGAATTGTGGATAATTTAGCAGGGGGAATTGCAGAATTGGGGATTTGGGAGCGAAGGAA
AGTGGGGGCGTATAGCAATTATCTATACATACGGCGTAGATACGGATACGGCTGGGTATA
CGTACATACGTATACGTATATGAACTGGTAGAGTACTGTTATTTATTGATGGCTGCCGCG
CTGGCCGGCCGTACGCCGGAGCGGCTGCAGGAACTGCGGCTCCGGTCACGGCTGCCGGCG
GCCGGTGTACGGTCGCCGTCGATTATTTATTATTTTACTAGTTATTTATTCTGAGCCGTG
GATGATGGCTTTGAGATCAGTGCACAGGTGCTTGGAGCCTTGGATCGCTTTACTCTCTCT
CTCTCTCCAATTTTCTTCAGTTCTATGAGAAAATTTGCAACGTTGAGTTGTAAATGGGAA
CAGCACTTAGAATTATGAATGATAAATTATTGTCACCTGATTTATACCAAGAGGGAATAA
TTATTCTTTTGTACT

CDS

1170 bp

>Os06t0573600-02 Similar to Beta-galactosidase.
CTGACGAACCTTCACAAGGCCATCAAGCAGGCCGAGACGGCGCTCGTTGCCGGCGACCCG
ACCGTCCAGAACATCGGCAACTACGAGAAGGCATACGTGTTCAGGTCGAGCAGCGGCGAC
TGCGCGGCGTTCCTGTCCAACTTCCACACGAGCGCGGCGGCGAGGGTGGCGTTCAACGGG
CGGCGGTACGACCTCCCGGCGTGGTCCATCAGCGTGCTGCCGGACTGCAGGACCGCCGTG
TACAACACCGCGACGGTGACGGCGGCGTCGTCGCCGGCGAAGATGAACCCGGCGGGCGGG
TTCACCTGGCAGTCGTACGGCGAGGCCACCAACTCGCTGGACGAGACGGCCTTCACCAAG
GACGGCCTCGTCGAGCAGCTCAGCATGACGTGGGACAAGTCCGACTACCTGTGGTACACC
ACCTACGTCAACATCGACTCCGGCGAGCAGTTCTTGAAGTCCGGCCAGTGGCCGCAGCTG
ACCGTCTACTCCGCCGGGCACAGCGTGCAGGTGTTCGTCAACGGGCAATACTTCGGCAAT
GCGTATGGTGGCTACGACGGGCCGAAGCTGACGTACAGTGGGTACGTCAAGATGTGGCAG
GGCAGTAACAAGATCTCCATCCTCAGCTCCGCCGTCGGCCTCCCGAACGTCGGCACGCAT
TATGAGACGTGGAACATCGGCGTGCTCGGCCCGGTGACGCTGTCCGGCCTCAACGAGGGG
AAGAGAGACCTCAGCAAACAGAAATGGACATACCAGATTGGCCTGAAGGGGGAGAAGCTG
GGGGTGCACTCCGTCAGCGGGAGCTCCTCCGTGGAGTGGGGCGGCGCCGCCGGCAAGCAG
CCGGTGACGTGGCACAGGGCCTACTTCAACGCGCCGGCCGGCGGCGCGCCGGTGGCGCTG
GACCTCGGCAGCATGGGGAAGGGCCAGGCGTGGGTGAACGGCCACCTCATCGGCCGCTAC
TGGTCCTACAAGGCCTCCGGCAACTGCGGCGGCTGCAGCTACGCCGGCACCTACTCCGAG
AAGAAGTGCCAGGCCAACTGCGGCGACGCCTCCCAGAGATGGTACCATGTCCCAAGATCA
TGGCTGAATCCTAGCGGGAACCTGGTGGTGCTGCTGGAAGAGTTCGGCGGCGACTTGTCC
GGGGTCACGTTGATGACGAGGACGACATGA

Protein

389 aa

>Os06t0573600-02 Similar to Beta-galactosidase.
LTNLHKAIKQAETALVAGDPTVQNIGNYEKAYVFRSSSGDCAAFLSNFHTSAAARVAFNG
RRYDLPAWSISVLPDCRTAVYNTATVTAASSPAKMNPAGGFTWQSYGEATNSLDETAFTK
DGLVEQLSMTWDKSDYLWYTTYVNIDSGEQFLKSGQWPQLTVYSAGHSVQVFVNGQYFGN
AYGGYDGPKLTYSGYVKMWQGSNKISILSSAVGLPNVGTHYETWNIGVLGPVTLSGLNEG
KRDLSKQKWTYQIGLKGEKLGVHSVSGSSSVEWGGAAGKQPVTWHRAYFNAPAGGAPVAL
DLGSMGKGQAWVNGHLIGRYWSYKASGNCGGCSYAGTYSEKKCQANCGDASQRWYHVPRS
WLNPSGNLVVLLEEFGGDLSGVTLMTRTT*

5'UTR

chr06:22248152..22248152 (+ strand) : 1 bp

CDS

chr06:22248153..22248242 (+ strand) : 90 bp

chr06:22248733..22249067 (+ strand) : 335 bp

chr06:22249644..22249753 (+ strand) : 110 bp

chr06:22249890..22249999 (+ strand) : 110 bp

chr06:22250123..22250233 (+ strand) : 111 bp

chr06:22250690..22250994 (+ strand) : 305 bp

chr06:22251087..22251195 (+ strand) : 109 bp

3'UTR

chr06:22251196..22251719 (+ strand) : 524 bp

FASTA

>Os06t0573600-02 class=Sequence position=chr06:22248152..22251719 (+ strand)
CCTGACGAAC CTTCACAAGG CCATCAAGCA GGCCGAGACG GCGCTCGTTG CCGGCGACCC GACCGTCCAG AACATCGGCA
ACTACGAGAA GGTCCATCTC ATCACAATTT TTTTCTGCAA AATTTCATAC TTAACCAGCA TTTTACCGTA CTTAGGAAGT
ATTGCGAGCT ACCATATTTT CTAATATAAA TTTTGGTAAC TCTCAGTACC TCCAATATTA TAAGGTACCA AAACTTGTAT
TAAAAATTTT GGTAATTCTT GATACTTCCC CGCTTTAGAT TATAAGTCAT TATGACtttg gtcaaagtca aatagctcta
agtttgacta agtttgtaga caaatataat aatatttaca acaccaaatt agttttatta aattaataat taaatatatt
tttataatat atttatctta ggttgaaaat ggtactactt tttttctacc aacttaatta aatttggagg agtATAGCGA
CTCATAATCT GAAGCGGAGG GAGTACATAT TAAGAACCGT AAAATTTCTT TAGCCTGCAA GTTCATGGCC GTGATCATTC
TTTTCCTGCA TTCTTTTTCA GGCATACGTG TTCAGGTCGA GCAGCGGCGA CTGCGCGGCG TTCCTGTCCA ACTTCCACAC
GAGCGCGGCG GCGAGGGTGG CGTTCAACGG GCGGCGGTAC GACCTCCCGG CGTGGTCCAT CAGCGTGCTG CCGGACTGCA
GGACCGCCGT GTACAACACC GCGACGGTGA CGGCGGCGTC GTCGCCGGCG AAGATGAACC CGGCGGGCGG GTTCACCTGG
CAGTCGTACG GCGAGGCCAC CAACTCGCTG GACGAGACGG CCTTCACCAA GGACGGCCTC GTCGAGCAGC TCAGCATGAC
GTGGGACAAG TCCGACTACC TGTGGTACAC CACCTAGTAA GTGATCCGAT GCCAACCAAA CCATCTCCGA TCAGGTCCTG
ACCTCTGAAG ATCgggtaat tttaccattc ttgataagat acctagaggt aatatatttt tatcttaggt acaaagtatc
ttaaggcacc agaaaattta gtgcagaact taggtacctc gaggtacttt ctaaaggata gtaaaatttc tcTATTTTCT
AGTGTAAAAT TTGATATCTC TAGAtactcc atccgtttca aaatgtttga caccgttgac tttttagtat gtgtttgacc
attcgtctta ttcaaaaaat ttaagtaatt atttattctt ttcatatcat ttgattcatt gttaaatata ttttcatgta
cacatatagt tttacatatt ttataaattt ttttaataag acgaataatc aaacacgtgt taaaaagtca acagtgtcaa
acattttaga acggagggag taCTATAAGT AACTTAAAGT ACTAAAAAAT TTTAGTGTAA AATTTTGGTA CCTCAAGTGA
CTATAAAATT CCTCTTGAAT ATTACTTGCT AATTAATTGT GTGTGTTGGC AGCGTCAACA TCGACTCCGG CGAGCAGTTC
TTGAAGTCCG GCCAGTGGCC GCAGCTGACC GTCTACTCCG CCGGGCACAG CGTGCAGGTG TTCGTCAACG GGCAATACTT
CGGTAACTCT CACTGAAATT TCTTCTTGAT GATGATGATG ATGATGATCA GACATTCAGA CAAATTAACC AACATTGATC
TTGAGATCGG TTCACTGATG ATTCACTGAT GAATGAATGA ATTTCGATGG TGTCGCAGGC AATGCGTATG GTGGCTACGA
CGGGCCGAAG CTGACGTACA GTGGGTACGT CAAGATGTGG CAGGGCAGTA ACAAGATCTC CATCCTCAGC TCCGCCGTCG
GCCTCCCGGT GAGCTCATCT CATCGATCAG TCATGATATT CAGATGATTC AAGATTTGTC ATTCAGATTT CAGACTTTTC
ATGTTCAGAA TTCAGATTAT AATTTTTCAA TCTTGGCCGT GATTTGTGCA GAACGTCGGC ACGCATTATG AGACGTGGAA
CATCGGCGTG CTCGGCCCGG TGACGCTGTC CGGCCTCAAC GAGGGGAAGA GAGACCTCAG CAAACAGAAA TGGACATACC
AGGTATAGTC CTATACTTCC CTcgttccac aatgcaagtc attttagcat ttcccacatt catattgatg ctaatgaatg
tgagaaatgc tagaatgagt tacattgtga aacggaggga gtaCTACTTT ACTAATCACG GTGGTCTTTA CCGATAGTAT
TTTTTATTAT CACAGTAAAA ATAATCTCAA CCACTAATTT ATGAGTTTTG CTATCAGTAA AAAAAAATTA CTACAAGTAG
TTAATATgat gggatttgct tcggtccaat aaaaagtatg tcgaggtacc agtaccttac ggtactaaat tgtttccgat
tattaggtct aacaatgtcc atcctactta actagatcca atgatcagaa acTAATATGA TAGAAAAAAT ACATATGATT
TATTAGATTA GAAGAAATGT ATAAACTGAT ATCATCTCTG CTGCATCTAT ATGCTTAGAT TGGCCTGAAG GGGGAGAAGC
TGGGGGTGCA CTCCGTCAGC GGGAGCTCCT CCGTGGAGTG GGGCGGCGCC GCCGGCAAGC AGCCGGTGAC GTGGCACAGG
GCCTACTTCA ACGCGCCGGC CGGCGGCGCG CCGGTGGCGC TGGACCTCGG CAGCATGGGG AAGGGCCAGG CGTGGGTGAA
CGGCCACCTC ATCGGCCGCT ACTGGTCCTA CAAGGCCTCC GGCAACTGCG GCGGCTGCAG CTACGCCGGC ACCTACTCCG
AGAAGAAGTG CCAGGCCAAC TGCGGCGACG CCTCCCAGAG ATGGTAAATT ATTAAATAAA TTTACTCAAA ACGGTTAAAT
TTTGAGCTGG ATTTGATCGA ATTTCTGTTC TTGTTTGCCT GGAAATTTTA ATCAGGTACC ATGTCCCAAG ATCATGGCTG
AATCCTAGCG GGAACCTGGT GGTGCTGCTG GAAGAGTTCG GCGGCGACTT GTCCGGGGTC ACGTTGATGA CGAGGACGAC
ATGAACAGGA GGAAGAATTG AAGTGGAGAT GATTTGAATT GTGGATAATT TAGCAGGGGG AATTGCAGAA TTGGGGATTT
GGGAGCGAAG GAAAGTGGGG GCGTATAGCA ATTATCTATA CATACGGCGT AGATACGGAT ACGGCTGGGT ATACGTACAT
ACGTATACGT ATATGAACTG GTAGAGTACT GTTATTTATT GATGGCTGCC GCGCTGGCCG GCCGTACGCC GGAGCGGCTG
CAGGAACTGC GGCTCCGGTC ACGGCTGCCG GCGGCCGGTG TACGGTCGCC GTCGATTATT TATTATTTTA CTAGTTATTT
ATTCTGAGCC GTGGATGATG GCTTTGAGAT CAGTGCACAG GTGCTTGGAG CCTTGGATCG CTTTACTCTC TCTCTCTCTC
CAATTTTCTT CAGTTCTATG AGAAAATTTG CAACGTTGAG TTGTAAATGG GAACAGCACT TAGAATTATG AATGATAAAT
TATTGTCACC TGATTTATAC CAAGAGGGAA TAATTATTCT TTTGTACT

Locus: Os06g0573600

Loading...

Locus: Os06g0573600

Loading...