Os06t0573600-03

Locus

Os06g0573600

Description

Similar to Beta-galactosidase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BGAL2

CGSNL Gene Name

BETA-GALACTOSIDASE 2

Oryzabase Gene Symbol Synonym(s)

OsBgal2, OsBGal2

Oryzabase Gene Name Synonym(s)

Beta-galactosidase 9, Lactase 9

Transcript Evidence

AK059741 (DDBJ, Best hit)

Protein Evidence

A2YEA5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase, family 35 (IPR001944)

Galactose-binding domain-like (IPR008979)

Full-length cDNA

006-202-F09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0573600-03)

RiceXPro (AK059741)

Others

Oryzabase (8290)

KEGG (Os06t0573600-03)

Transcript

999 bp

>Os06t0573600-03 Similar to Beta-galactosidase.
ATGCTTAGATTGGCCTGAAGGGGGAGAAGCTGGGGGTGCACTCCGTCAGCGGGAGCTCCT
CCGTGGAGTGGGGCGGCGCCGCCGGCAAGCAGCCGGTGACGTGGCACAGGGCCTACTTCA
ACGCGCCGGCCGGCGGCGCGCCGGTGGCGCTGGACCTCGGCAGCATGGGGAAGGGCCAGG
CGTGGGTGAACGGCCACCTCATCGGCCGCTACTGGTCCTACAAGGCCTCCGGCAACTGCG
GCGGCTGCAGCTACGCCGGCACCTACTCCGAGAAGAAGTGCCAGGCCAACTGCGGCGACG
CCTCCCAGAGATGGTACCATGTCCCAAGATCATGGCTGAATCCTAGCGGGAACCTGGTGG
TGCTGCTGGAAGAGTTCGGCGGCGACTTGTCCGGGGTCACGTTGATGACGAGGACGACAT
GAACAGGAGGAAGAATTGAAGTGGAGATGATTTGAATTGTGGATAATTTAGCAGGGGGAA
TTGCAGAATTGGGGATTTGGGAGCGAAGGAAAGTGGGGGCGTATAGCAATTATCTATACA
TACGGCGTAGATACGGATACGGCTGGGTATACGTACATACGTATACGTATATGAACTGGT
AGAGTACTGTTATTTATTGATGGCTGCCGCGCTGGCCGGCCGTACGCCGGAGCGGCTGCA
GGAACTGCGGCTCCGGTCACGGCTGCCGGCGGCCGGTGTACGGTCGCCGTCGATTATTTA
TTATTTTACTAGTTATTTATTCTGAGCCGTGGATGATGGCTTTGAGATCAGTGCACAGGT
GCTTGGAGCCTTGGATCGCTTTACTCTCTCTCTCTCTCCAATTTTCTTCAGTTCTATGAG
AAAATTTGCAACGTTGAGTTGTAAATGGGAACAGCACTTAGAATTATGAATGATAAATTA
TTGTCACCTGATTTATACCAAGAGGGAATAATTATTCTTTTGTACTATATTGCAAGTTTT
CTTTGTCCTTCCCAGTAATTAAATGGTGAGATTTATACG

CDS

414 bp

>Os06t0573600-03 Similar to Beta-galactosidase.
ATTGGCCTGAAGGGGGAGAAGCTGGGGGTGCACTCCGTCAGCGGGAGCTCCTCCGTGGAG
TGGGGCGGCGCCGCCGGCAAGCAGCCGGTGACGTGGCACAGGGCCTACTTCAACGCGCCG
GCCGGCGGCGCGCCGGTGGCGCTGGACCTCGGCAGCATGGGGAAGGGCCAGGCGTGGGTG
AACGGCCACCTCATCGGCCGCTACTGGTCCTACAAGGCCTCCGGCAACTGCGGCGGCTGC
AGCTACGCCGGCACCTACTCCGAGAAGAAGTGCCAGGCCAACTGCGGCGACGCCTCCCAG
AGATGGTACCATGTCCCAAGATCATGGCTGAATCCTAGCGGGAACCTGGTGGTGCTGCTG
GAAGAGTTCGGCGGCGACTTGTCCGGGGTCACGTTGATGACGAGGACGACATGA

Protein

137 aa

>Os06t0573600-03 Similar to Beta-galactosidase.
IGLKGEKLGVHSVSGSSSVEWGGAAGKQPVTWHRAYFNAPAGGAPVALDLGSMGKGQAWV
NGHLIGRYWSYKASGNCGGCSYAGTYSEKKCQANCGDASQRWYHVPRSWLNPSGNLVVLL
EEFGGDLSGVTLMTRTT*

5'UTR

chr06:22250682..22250689 (+ strand) : 8 bp

CDS

chr06:22250690..22250994 (+ strand) : 305 bp

chr06:22251087..22251195 (+ strand) : 109 bp

3'UTR

chr06:22251196..22251772 (+ strand) : 577 bp

FASTA

>Os06t0573600-03 class=Sequence position=chr06:22250682..22251772 (+ strand)
ATGCTTAGAT TGGCCTGAAG GGGGAGAAGC TGGGGGTGCA CTCCGTCAGC GGGAGCTCCT CCGTGGAGTG GGGCGGCGCC
GCCGGCAAGC AGCCGGTGAC GTGGCACAGG GCCTACTTCA ACGCGCCGGC CGGCGGCGCG CCGGTGGCGC TGGACCTCGG
CAGCATGGGG AAGGGCCAGG CGTGGGTGAA CGGCCACCTC ATCGGCCGCT ACTGGTCCTA CAAGGCCTCC GGCAACTGCG
GCGGCTGCAG CTACGCCGGC ACCTACTCCG AGAAGAAGTG CCAGGCCAAC TGCGGCGACG CCTCCCAGAG ATGGTAAATT
ATTAAATAAA TTTACTCAAA ACGGTTAAAT TTTGAGCTGG ATTTGATCGA ATTTCTGTTC TTGTTTGCCT GGAAATTTTA
ATCAGGTACC ATGTCCCAAG ATCATGGCTG AATCCTAGCG GGAACCTGGT GGTGCTGCTG GAAGAGTTCG GCGGCGACTT
GTCCGGGGTC ACGTTGATGA CGAGGACGAC ATGAACAGGA GGAAGAATTG AAGTGGAGAT GATTTGAATT GTGGATAATT
TAGCAGGGGG AATTGCAGAA TTGGGGATTT GGGAGCGAAG GAAAGTGGGG GCGTATAGCA ATTATCTATA CATACGGCGT
AGATACGGAT ACGGCTGGGT ATACGTACAT ACGTATACGT ATATGAACTG GTAGAGTACT GTTATTTATT GATGGCTGCC
GCGCTGGCCG GCCGTACGCC GGAGCGGCTG CAGGAACTGC GGCTCCGGTC ACGGCTGCCG GCGGCCGGTG TACGGTCGCC
GTCGATTATT TATTATTTTA CTAGTTATTT ATTCTGAGCC GTGGATGATG GCTTTGAGAT CAGTGCACAG GTGCTTGGAG
CCTTGGATCG CTTTACTCTC TCTCTCTCTC CAATTTTCTT CAGTTCTATG AGAAAATTTG CAACGTTGAG TTGTAAATGG
GAACAGCACT TAGAATTATG AATGATAAAT TATTGTCACC TGATTTATAC CAAGAGGGAA TAATTATTCT TTTGTACTAT
ATTGCAAGTT TTCTTTGTCC TTCCCAGTAA TTAAATGGTG AGATTTATAC G

Locus: Os06g0573600

Loading...

Locus: Os06g0573600

Loading...