Os06t0583900-01

Locus

Os06g0583900

Description

Similar to Pectate lyase homolog (EC 4.2.2.2) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPLL9, PLL9

Oryzabase Gene Name Synonym(s)

Pectate lyase-like 9

Transcript Evidence

AK072583 (DDBJ, Best hit)

Protein Evidence

B8B435 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: pectate lyase activity (GO:0030570)

Functional domain (InterPro)

Pectate lyase/Amb allergen (IPR002022)

Pectate lyase, N-terminal (IPR007524)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

AmbAllergen (IPR018082)

Full-length cDNA

J023132G06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0583900-01)

RiceXPro (AK072583)

Others

Oryzabase (22494)

KEGG (Os06t0583900-01 (EC:4.2.2.2))

Transcript

2075 bp

>Os06t0583900-01 Similar to Pectate lyase homolog (EC 4.2.2.2) (Fragment).
GCACAGGCCGAGCAATGGAGCTCATCGTCCTACCTTCACACAGCTGAAAAAATTCCCTCA
TATACAAGATAAAGGTAGGAGGAGGGCCGGGAGCTCGACGGATTTCGATCAATTGTGGTT
TTTTTTTGTGGTAACCGTATAAGAGAGGAGATTTTGTTTAACGTAGCTAGATCATATCTG
AGTTGAGTTTTAGCAATGGAGGTGCTGATCCGGTGGAGCAAGCTGCCGGCGGCCGGCTCC
TTGGTGCTGTACGCCGTCTTCTTATTGCTGTCGGCGGCAGCCACATCGGAGGCCAACATC
GGGGAGTACGATGAGTACTGGCAGAAGCGCAAGCTCATGGCTGATGCCGCCGCCGAGGCT
ACCTACAAGCGTGACCCCTTCGAGGTCACCAACAGCTTCAACCGCGCCGTCCACAGATCG
GAGGAGGAGAGCGGGAGGAGGGAGCTGGCGATGACGAAGAGGAAGAAGTTCGCGgggccg
tgcaaggcgacgaacccgatcgaccggtgctggaggtgccgcgccgactgggtgacggac
aggaagcggctggcgcggtgcgcgcaggggttcggccggaacaccaccggagggctggcc
gggaagttctacctggtgacggacggcaccgacgacgacgtggagaacccgcgcccgggg
acgctccggtggggtgtcatccaggacgagccactgtggatcatcttcgccaaggacatg
atcatcaacctcaaggaggagatgatgatcaacagcgacaagacgatcgacgggcgggga
gcgcaggtgcggatcaccaatggcgcgcaggtgacggtgcagaactccaacaacgtgatc
atccacaacatccacatccacgacatcttgcaaggcaagggcgggatgatccgcgactcg
ccggagcacttcggcttccgcacccagtccgacggcgacggcatcagcatcttcggctcc
accaacgtctggctcgaccacctctccctctccaactgccaggacggcctcatcgacgtc
atcgccaagtccaccggagtcaccatctccaactgccacctcaccaaccacaacgacgtc
atgctcttcggctccagcgactccttcagcgaggaccagatcatgcagatcaccgtcgct
ttcaaccacttcggccgcggcctcgtccaaagaatgcccagatgccgatggggatttttc
cacgtggtgaacaacgactacacgcactggctcatgtatgccatcggagggagcaagaac
ccgacgatcatcagccaggggaacaggtacatcgcgccgccaaacctagcggcgaagcgg
atcacgaagcagctcggggcgacggaggaggagtggaagaactgggtgtggcactctgag
gaggacctgttcatggagggggcctacttcaccacgtccggtggcccgatccagaagcag
ttcagcaacaaggatctgatcaagcccaagcccggatcctacgtcacgaggctcacccgc
ttcgctggctccatcccatgcgtggccggcaagccgtgctagAGCGCGGTGGCCGGCCCC
CACCGGATCCACGGCTAGCCGGAGATGATTCTTATTTTGTAGTTGTGTGAGCTTATTTTT
TCTTCTACACATACGTACTTACTCAAGAAATCTTGATCTGTGGCCGGCCGGGTTCTGGTC
AATGTGATCCTATAGGTTCTACATATAAAAAAGTTGTATTAATTAAAAGCATTTTTGGAA
GCGGTGGCGATGCAAATTTAGAGGGCGATAGGGCGAGGAGCATGCATGTTTGTGCGTATA
GGTCTACTTGTTGATGGTGATCACGAAAGAGCCAATGCATTGTCATGATAGAGGACATGC
GCATTTATGCAGAAGGCCCTAGGGCAGGAATTATTTTTTTTTCATTGATTGTTTTAAATG
TATTGTACTGAAACTACATTGTTGTTTCATTAACTGCACGCATCTCCAATGCAAAGTGCT
AATGTAAGGTGTTTAATATATAGTGCTAATGTAAAGTGCAATGAAGCATCTCACTACTAT
AGAAGATGACTTCAGTGTCGGGTCGTAACCCCTCA

CDS

1347 bp

>Os06t0583900-01 Similar to Pectate lyase homolog (EC 4.2.2.2) (Fragment).
ATGGAGGTGCTGATCCGGTGGAGCAAGCTGCCGGCGGCCGGCTCCTTGGTGCTGTACGCC
GTCTTCTTATTGCTGTCGGCGGCAGCCACATCGGAGGCCAACATCGGGGAGTACGATGAG
TACTGGCAGAAGCGCAAGCTCATGGCTGATGCCGCCGCCGAGGCTACCTACAAGCGTGAC
CCCTTCGAGGTCACCAACAGCTTCAACCGCGCCGTCCACAGATCGGAGGAGGAGAGCGGG
AGGAGGGAGCTGGCGATGACGAAGAGGAAGAAGTTCGCGgggccgtgcaaggcgacgaac
ccgatcgaccggtgctggaggtgccgcgccgactgggtgacggacaggaagcggctggcg
cggtgcgcgcaggggttcggccggaacaccaccggagggctggccgggaagttctacctg
gtgacggacggcaccgacgacgacgtggagaacccgcgcccggggacgctccggtggggt
gtcatccaggacgagccactgtggatcatcttcgccaaggacatgatcatcaacctcaag
gaggagatgatgatcaacagcgacaagacgatcgacgggcggggagcgcaggtgcggatc
accaatggcgcgcaggtgacggtgcagaactccaacaacgtgatcatccacaacatccac
atccacgacatcttgcaaggcaagggcgggatgatccgcgactcgccggagcacttcggc
ttccgcacccagtccgacggcgacggcatcagcatcttcggctccaccaacgtctggctc
gaccacctctccctctccaactgccaggacggcctcatcgacgtcatcgccaagtccacc
ggagtcaccatctccaactgccacctcaccaaccacaacgacgtcatgctcttcggctcc
agcgactccttcagcgaggaccagatcatgcagatcaccgtcgctttcaaccacttcggc
cgcggcctcgtccaaagaatgcccagatgccgatggggatttttccacgtggtgaacaac
gactacacgcactggctcatgtatgccatcggagggagcaagaacccgacgatcatcagc
caggggaacaggtacatcgcgccgccaaacctagcggcgaagcggatcacgaagcagctc
ggggcgacggaggaggagtggaagaactgggtgtggcactctgaggaggacctgttcatg
gagggggcctacttcaccacgtccggtggcccgatccagaagcagttcagcaacaaggat
ctgatcaagcccaagcccggatcctacgtcacgaggctcacccgcttcgctggctccatc
ccatgcgtggccggcaagccgtgctag

Protein

448 aa

>Os06t0583900-01 Similar to Pectate lyase homolog (EC 4.2.2.2) (Fragment).
MEVLIRWSKLPAAGSLVLYAVFLLLSAAATSEANIGEYDEYWQKRKLMADAAAEATYKRD
PFEVTNSFNRAVHRSEEESGRRELAMTKRKKFAGPCKATNPIDRCWRCRADWVTDRKRLA
RCAQGFGRNTTGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIINLK
EEMMINSDKTIDGRGAQVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFG
FRTQSDGDGISIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGS
SDSFSEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIIS
QGNRYIAPPNLAAKRITKQLGATEEEWKNWVWHSEEDLFMEGAYFTTSGGPIQKQFSNKD
LIKPKPGSYVTRLTRFAGSIPCVAGKPC*

5'UTR

chr06:22821117..22821311 (+ strand) : 195 bp

CDS

chr06:22821312..22821529 (+ strand) : 218 bp

chr06:22821612..22822379 (+ strand) : 768 bp

chr06:22822493..22822853 (+ strand) : 361 bp

3'UTR

chr06:22822854..22823386 (+ strand) : 533 bp

FASTA

>Os06t0583900-01 class=Sequence position=chr06:22821117..22823386 (+ strand)
GCACAGGCCG AGCAATGGAG CTCATCGTCC TACCTTCACA CAGCTGAAAA AATTCCCTCA TATACAAGAT AAAGGTAGGA
GGAGGGCCGG GAGCTCGACG GATTTCGATC AATTGTGGTT TTTTTTTGTG GTAACCGTAT AAGAGAGGAG ATTTTGTTTA
ACGTAGCTAG ATCATATCTG AGTTGAGTTT TAGCAATGGA GGTGCTGATC CGGTGGAGCA AGCTGCCGGC GGCCGGCTCC
TTGGTGCTGT ACGCCGTCTT CTTATTGCTG TCGGCGGCAG CCACATCGGA GGCCAACATC GGGGAGTACG ATGAGTACTG
GCAGAAGCGC AAGCTCATGG CTGATGCCGC CGCCGAGGCT ACCTACAAGC GTGACCCCTT CGAGGTCACC AACAGCTTCA
ACCGCGCCGT CCACAGGCAC GCCGATCGTT CGTTCAATCA ATCAATCGTG AGAATAGCTC AGTTGGTTAG AACATATGAT
AGTAACGTGT GCGTGCAGAT CGGAGGAGGA GAGCGGGAGG AGGGAGCTGG CGATGACGAA GAGGAAGAAG TTCGCGgggc
cgtgcaaggc gacgaacccg atcgaccggt gctggaggtg ccgcgccgac tgggtgacgg acaggaagcg gctggcgcgg
tgcgcgcagg ggttcggccg gaacaccacc ggagggctgg ccgggaagtt ctacctggtg acggacggca ccgacgacga
cgtggagaac ccgcgcccgg ggacgctccg gtggggtgtc atccaggacg agccactgtg gatcatcttc gccaaggaca
tgatcatcaa cctcaaggag gagatgatga tcaacagcga caagacgatc gacgggcggg gagcgcaggt gcggatcacc
aatggcgcgc aggtgacggt gcagaactcc aacaacgtga tcatccacaa catccacatc cacgacatct tgcaaggcaa
gggcgggatg atccgcgact cgccggagca cttcggcttc cgcacccagt ccgacggcga cggcatcagc atcttcggct
ccaccaacgt ctggctcgac cacctctccc tctccaactg ccaggacggc ctcatcgacg tcatcgccaa gtccaccgga
gtcaccatct ccaactgcca cctcaccaac cacaacgacg tcatgctctt cggctccagc gactccttca gcgaggacca
gatcatgcag atcaccgtcg ctttcaacca cttcggccgc ggcctcgtcc aaagaatgcc caggtcacat aataatacta
ccagtagaga acaccataca taaaatatta ataataataa tattatatta ttatatatat aacatcattc attattattt
atcatgtatt gtgcagatgc cgatggggat ttttccacgt ggtgaacaac gactacacgc actggctcat gtatgccatc
ggagggagca agaacccgac gatcatcagc caggggaaca ggtacatcgc gccgccaaac ctagcggcga agcggatcac
gaagcagctc ggggcgacgg aggaggagtg gaagaactgg gtgtggcact ctgaggagga cctgttcatg gagggggcct
acttcaccac gtccggtggc ccgatccaga agcagttcag caacaaggat ctgatcaagc ccaagcccgg atcctacgtc
acgaggctca cccgcttcgc tggctccatc ccatgcgtgg ccggcaagcc gtgctagAGC GCGGTGGCCG GCCCCCACCG
GATCCACGGC TAGCCGGAGA TGATTCTTAT TTTGTAGTTG TGTGAGCTTA TTTTTTCTTC TACACATACG TACTTACTCA
AGAAATCTTG ATCTGTGGCC GGCCGGGTTC TGGTCAATGT GATCCTATAG GTTCTACATA TAAAAAAGTT GTATTAATTA
AAAGCATTTT TGGAAGCGGT GGCGATGCAA ATTTAGAGGG CGATAGGGCG AGGAGCATGC ATGTTTGTGC GTATAGGTCT
ACTTGTTGAT GGTGATCACG AAAGAGCCAA TGCATTGTCA TGATAGAGGA CATGCGCATT TATGCAGAAG GCCCTAGGGC
AGGAATTATT TTTTTTTCAT TGATTGTTTT AAATGTATTG TACTGAAACT ACATTGTTGT TTCATTAACT GCACGCATCT
CCAATGCAAA GTGCTAATGT AAGGTGTTTA ATATATAGTG CTAATGTAAA GTGCAATGAA GCATCTCACT ACTATAGAAG
ATGACTTCAG TGTCGGGTCG TAACCCCTCA 

Locus: Os06g0583900

Loading...

Locus: Os06g0583900

Loading...