Os06t0584000-00

Locus

Os06g0584000

Description

Similar to pectate lyase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPLL10, PLL10

Oryzabase Gene Name Synonym(s)

Pectate lyase-like 10

Transcript Evidence

tplb0007g05 (Wheat FLcDNA)

Protein Evidence

NP_001150723.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Pectate lyase/Amb allergen (IPR002022)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

AmbAllergen (IPR018082)

Expression Databases

TENOR (Os06t0584000-00)

Others

Oryzabase (22495)

Transcript

1273 bp

>Os06t0584000-00 Similar to pectate lyase.
GAGGAGTTGAGCGGGAGAAGGAAGCTGGCGATGACGAAGAGGAAGAAGTTCGCGgggcca
tgcaaggcgacttatccgatcgaccggtgctagaggtgccgcaccgactgggcgacggac
aggaagcggctggcgctgtgcgcacaagggttcggcttaaacaccaccggagggttggcc
gggaagttctacctagtgacggacggcaccgacgatgacgcggtgaatccgccccgggga
cgctccgttggggtgtgatccaggacgagccactgtggatcatctttgccaaggagatga
tcatcaacctcaaggaggggatgatgatcaatagcgacaagacaatcgacaggcggggag
cgcatgtgcggatcaccaatggcgtgcaggtgacggtgcagaactccaacaacgtgatca
tccacaacatccacatccacgacatcgtgctcggcaagttggggatgatccgcgactcgc
tggagcagttcggcttccgcacccagtccgacagcgatgacatcaacatcttcggctcca
ccaacgtctagctcgaccacctctccctctccaactgcaaggacggcctcatcgacgtca
tcgccaagtccaccggagtcaccatgcatctccaactaccacctcaccaaccacaacgac
atcaggctcttcagctccagtgactccttcagcgaggaccagatcatgcagatcactgtc
gccttcaaccagtttggctgcagcctcgtctaaggaatgcccagatgccgatggggatat
ttccacgtggtgaacaatgactacacgcactggctgatgtacgccatcggagggagcaag
aacccgacgatcattagccaggggaaccggtacactgctccaccgaacctgacggcaaag
cagatcacgaagcatctcggtgcggcggaggaggagtggaagaactgggtgtacatggca
cttggaggaggacctgttcatggaggggacctacttcaccacgtccggcgatgcgaccca
gaagcagttcagcaacaaggacctgatcaagcccaagcctggatcctacgtcgcgaggct
cacgcgcttcgccggcttcatcccgtgcactcccggcaagaagtgctagACCGCGCGCGG
CGGGCGGCTAGCCGGAGAGACGATTCTTATTTGTAGTTGTGTGAGCTTAATTTTTTTTCT
TCTACATATACGTATACTTATTCAAGAAATCTTGATCTGTGGCCGGGTTCTGGTCAATGT
GATCCTATAGGTT

CDS

333 bp

>Os06t0584000-00 Similar to pectate lyase.
cgcggtgaatccgccccggggacgctccgttggggtgtgatccaggacgagccactgtgg
atcatctttgccaaggagatgatcatcaacctcaaggaggggatgatgatcaatagcgac
aagacaatcgacaggcggggagcgcatgtgcggatcaccaatggcgtgcaggtgacggtg
cagaactccaacaacgtgatcatccacaacatccacatccacgacatcgtgctcggcaag
ttggggatgatccgcgactcgctggagcagttcggcttccgcacccagtccgacagcgat
gacatcaacatcttcggctccaccaacgtctag

Protein

110 aa

>Os06t0584000-00 Similar to pectate lyase.
RGESAPGTLRWGVIQDEPLWIIFAKEMIINLKEGMMINSDKTIDRRGAHVRITNGVQVTV
QNSNNVIIHNIHIHDIVLGKLGMIRDSLEQFGFRTQSDSDDINIFGSTNV*

5'UTR

chr06:22825043..22825260 (+ strand) : 218 bp

CDS

chr06:22825261..22825593 (+ strand) : 333 bp

3'UTR

chr06:22825594..22825806 (+ strand) : 213 bp

chr06:22825908..22826416 (+ strand) : 509 bp

FASTA

>Os06t0584000-00 class=Sequence position=chr06:22825043..22826416 (+ strand)
GAGGAGTTGA GCGGGAGAAG GAAGCTGGCG ATGACGAAGA GGAAGAAGTT CGCGgggcca tgcaaggcga cttatccgat
cgaccggtgc tagaggtgcc gcaccgactg ggcgacggac aggaagcggc tggcgctgtg cgcacaaggg ttcggcttaa
acaccaccgg agggttggcc gggaagttct acctagtgac ggacggcacc gacgatgacg cggtgaatcc gccccgggga
cgctccgttg gggtgtgatc caggacgagc cactgtggat catctttgcc aaggagatga tcatcaacct caaggagggg
atgatgatca atagcgacaa gacaatcgac aggcggggag cgcatgtgcg gatcaccaat ggcgtgcagg tgacggtgca
gaactccaac aacgtgatca tccacaacat ccacatccac gacatcgtgc tcggcaagtt ggggatgatc cgcgactcgc
tggagcagtt cggcttccgc acccagtccg acagcgatga catcaacatc ttcggctcca ccaacgtcta gctcgaccac
ctctccctct ccaactgcaa ggacggcctc atcgacgtca tcgccaagtc caccggagtc accatgcatc tccaactacc
acctcaccaa ccacaacgac atcaggctct tcagctccag tgactccttc agcgaggacc agatcatgca gatcactgtc
gccttcaacc agtttggctg cagcctcgtc taaggaatgc ccaggtcaca taataatact accagtagag atcaccgtac
ataaaaaata ttattatata tatgtatata acatcattta ttactattta tcatgtgttg tgcagatgcc gatggggata
tttccacgtg gtgaacaatg actacacgca ctggctgatg tacgccatcg gagggagcaa gaacccgacg atcattagcc
aggggaaccg gtacactgct ccaccgaacc tgacggcaaa gcagatcacg aagcatctcg gtgcggcgga ggaggagtgg
aagaactggg tgtacatggc acttggagga ggacctgttc atggagggga cctacttcac cacgtccggc gatgcgaccc
agaagcagtt cagcaacaag gacctgatca agcccaagcc tggatcctac gtcgcgaggc tcacgcgctt cgccggcttc
atcccgtgca ctcccggcaa gaagtgctag ACCGCGCGCG GCGGGCGGCT AGCCGGAGAG ACGATTCTTA TTTGTAGTTG
TGTGAGCTTA ATTTTTTTTC TTCTACATAT ACGTATACTT ATTCAAGAAA TCTTGATCTG TGGCCGGGTT CTGGTCAATG
TGATCCTATA GGTT

Locus: Os06g0584000

Loading...

Locus: Os06g0584000

Loading...