Os06t0592400-01

Locus

Os06g0592400

Description

Similar to Cytosolic aldehyde dehydrogenase RF2C.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH2B2

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 2B2

Oryzabase Gene Symbol Synonym(s)

OsALDH2B2

Oryzabase Gene Name Synonym(s)

aldehyde dehydrogenase, Aldehyde dehydrogenase 2B2

Transcript Evidence

AK062788 (DDBJ, Best hit)

Protein Evidence

NP_001105046.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

001-107-B11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0592400-01)

RiceXPro (AK062788)

Others

Oryzabase (20166)

KEGG (Os06t0592400-01 (EC:1.2.1.3))

Transcript

502 bp

>Os06t0592400-01 Similar to Cytosolic aldehyde dehydrogenase RF2C.
CATGATATGTCATATCAATTCAAAATGTTTATTATCTAAGAAACTACTATAGTGGTAAGA
GAGATTAATTTTGGGTGCAGGACGGTGGAGGAGGCGATCGAGAGGGCGAACGGGACGAGG
TACGGGCTGGCGGCGGGGCTGGTGACGAGGGACATCGACGTGGCGAACCGGATGGCGAGG
TCGATCCGGGCAGGGGTGGTGTGGGTGAACTGCTACTTCGCCATGGACAGGAGCTGCCCG
TTCGGTGGCCGCAAGATGAGCGGGTTCGGCAAGGACGACAGCATGCACGCGCTCGACAAG
TTCCTCGCCGTCAAGTCCGTCGTCACCCCCGTCCATGGCTCCCCCTGGTTCTGAGTTCTT
TCTGGATCTCGTCGCCGATCGAGTCGGCCATGCGTATGTACACATGTTGGTGTTGTTGGA
TTTGCTGGGTGGTGGAGTATTTGTAACGGTGGAAGATTATTACAGAGAGTCAATAAGTTG
CATTATCCATTATTTTCCTTGT

CDS

315 bp

>Os06t0592400-01 Similar to Cytosolic aldehyde dehydrogenase RF2C.
GAAACTACTATAGTGGTAAGAGAGATTAATTTTGGGTGCAGGACGGTGGAGGAGGCGATC
GAGAGGGCGAACGGGACGAGGTACGGGCTGGCGGCGGGGCTGGTGACGAGGGACATCGAC
GTGGCGAACCGGATGGCGAGGTCGATCCGGGCAGGGGTGGTGTGGGTGAACTGCTACTTC
GCCATGGACAGGAGCTGCCCGTTCGGTGGCCGCAAGATGAGCGGGTTCGGCAAGGACGAC
AGCATGCACGCGCTCGACAAGTTCCTCGCCGTCAAGTCCGTCGTCACCCCCGTCCATGGC
TCCCCCTGGTTCTGA

Protein

105 aa

>Os06t0592400-01 Similar to Cytosolic aldehyde dehydrogenase RF2C.
ETTIVVREINFGCRTVEEAIERANGTRYGLAAGLVTRDIDVANRMARSIRAGVVWVNCYF
AMDRSCPFGGRKMSGFGKDDSMHALDKFLAVKSVVTPVHGSPWF*

5'UTR

chr06:23291753..23291791 (+ strand) : 39 bp

CDS

chr06:23291792..23292106 (+ strand) : 315 bp

3'UTR

chr06:23292107..23292254 (+ strand) : 148 bp

FASTA

>Os06t0592400-01 class=Sequence position=chr06:23291753..23292254 (+ strand)
CATGATATGT CATATCAATT CAAAATGTTT ATTATCTAAG AAACTACTAT AGTGGTAAGA GAGATTAATT TTGGGTGCAG
GACGGTGGAG GAGGCGATCG AGAGGGCGAA CGGGACGAGG TACGGGCTGG CGGCGGGGCT GGTGACGAGG GACATCGACG
TGGCGAACCG GATGGCGAGG TCGATCCGGG CAGGGGTGGT GTGGGTGAAC TGCTACTTCG CCATGGACAG GAGCTGCCCG
TTCGGTGGCC GCAAGATGAG CGGGTTCGGC AAGGACGACA GCATGCACGC GCTCGACAAG TTCCTCGCCG TCAAGTCCGT
CGTCACCCCC GTCCATGGCT CCCCCTGGTT CTGAGTTCTT TCTGGATCTC GTCGCCGATC GAGTCGGCCA TGCGTATGTA
CACATGTTGG TGTTGTTGGA TTTGCTGGGT GGTGGAGTAT TTGTAACGGT GGAAGATTAT TACAGAGAGT CAATAAGTTG
CATTATCCAT TATTTTCCTT GT

Locus: Os06g0592400

Loading...

Locus: Os06g0592400

Loading...