Os06t0594600-01

Locus

Os06g0594600

Description

BAHD acyltransferase, Glucuronoarabinoxylan modification in grass cell wall

RAP-DB Gene Symbol Synonym(s)

OsAT10, OsAt10

RAP-DB Gene Name Synonym(s)

acyltransferase10

CGSNL Gene Symbol

AT10

CGSNL Gene Name

ACYLTRANSFERASE 10

Oryzabase Gene Symbol Synonym(s)

OsAT10, OsAt10

Oryzabase Gene Name Synonym(s)

acyltransferase 10

Transcript Evidence

Inferred from literature

Protein Evidence

Q69UE6

Literature

PMID: 23391577

Note

Manual Curation

April 3, 2014

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Expression Databases

TENOR (Os06t0594600-00)

Others

Oryzabase (11742)

Transcript

1734 bp

>Os06t0594600-01 BAHD acyltransferase, Glucuronoarabinoxylan modification in grass cell wall
CCACACGCACACAGTTAGCTCTAGCTTTGCTTGATTTGCAGCAGCAGCAGCAGCAGCAGC
AGCTAgcttgcatccatgggcgtcttcgccgtcaccaaggtgtccgagggccccgtccgg
ccgtccgcagcgacgccgtcggagacgctgccgctcgcctgggtcgaccgctacccgacg
caccgcggcctcgtcgagtccgtgcacatctacctccgccgcgacgacgccgccgtcgag
gcgccgtgcgccgacggcggcgtcatcgtcGAGGGAAAGAAGAAGAATAATAAGCCGGCG
GCGGCGGTGGTGCGCGgcgcgctggcggacgcgctggtgcactactacccgttcgcgggg
cggatcgtggaggacgagcggtcgccggggcggcctgccgtgctgtgctccggcgagggc
gtctacttcgtggaggccgccgccaactgcaccctcgccgacgtcAACCACCTGGAGCGG
CCGCTGCTGCTGTCCAAGGAGGACCTCGTGCCGTGCCCGACGCCGGAGCAGTGGCCCGTC
GAGCCGCACAACAGCCTCGCCATGATCCAGGTGACGACGTTCACCTGCGGCGGCTTCGTG
ATCGGGCTGCGCACCAACCACGCGGTGGCGGACGGCACCGGCGCCGCCCAGTTCATGAAC
GCCGTCGGCGACCTCGCCCGCGGCCTCCCGGAGCCGCGGGTGAAGCCGATCTGGGCGCGC
GACCGCTTCCCGGACCCGGACATCAAGCCCGGCCCGCTGCCGGAGCTCCCCGTGCTGCCG
CTCCAGTACATCGCCTTCGACTTCCCCGCCGCCTACCTCGGCAAGCTCAAGGCGCAGTAC
GCCGCCACCGCCGGCGCCAGCAAGATCTGCTCCGCCTTCGACATCGTCATCGCCAAGCTC
TGGCAGTGCCGGACGCGCGCCATCGCCGCCGACCCCGCCGCGGCCGTCAAGCTCTGCTTC
TTCGCCAGCGCCCGCCAGGTGCTCGGCCTGGAGACCGGCTACTGGGGCAACGCCATCTTC
CCGGTGAAGGTGTCCGCGGCGGCGGGGGAGGTGGCGGCGTCGTCGGTGATCGAGCTCGTC
GGCGTGGTCCGGGAGGCGAAGCGGCGGATGGCCGGCGAGTGCCTGCGCTGGGCGGAGGGG
CGCACCGGCGGCGCCGACCCGTTCCAGATGACGTTCGACTACGAGTCCGTGTACGTGTCG
GACTGGAGCAAGCTCGGGTTCAACGACGTCGACTACGGGTACGGCGCGCCGTCGGCGGCG
GGGCCGCTGGTGAACTGCGACCTCATCTCGTCGGTGATCGTCATGCGGGCGCCGGCGCCG
CTCGCCGGCACGCGGCTGCTGGCGAGCTGCGTCACCAAGGAGCACGCCGACGACTTCGCC
GCCAGGATGAGGGAGGATCTCGTCTAATATACCATGGCCGCCCCCAATAACATTATTAGT
CACGTACAATATTGTCACTGAATATTAATTTGTTCGTGTATATCTATTGTGGTATGTATT
TTTTTTTTCATAGGAAAAAAGTAGTAGTACGACAATAGGTAGCTGGGAGCTACCTAATAT
CGACCTCTGGTTTGAGAGTAAGTGAGCGAGCGAGAGATGTAAACCACCTCAGTTTTTACC
GTGCTTTGTGACATGCGTGGTACAGTACTGGTACTATTAATCATTGGCCGTGAAAAATTA
TCTACCCATATGCCACTGTATTTATGGTTGTTTGTGGAGGATTACGTATACTAA

CDS

1332 bp

>Os06t0594600-01 BAHD acyltransferase, Glucuronoarabinoxylan modification in grass cell wall
atgggcgtcttcgccgtcaccaaggtgtccgagggccccgtccggccgtccgcagcgacg
ccgtcggagacgctgccgctcgcctgggtcgaccgctacccgacgcaccgcggcctcgtc
gagtccgtgcacatctacctccgccgcgacgacgccgccgtcgaggcgccgtgcgccgac
ggcggcgtcatcgtcGAGGGAAAGAAGAAGAATAATAAGCCGGCGGCGGCGGTGGTGCGC
Ggcgcgctggcggacgcgctggtgcactactacccgttcgcggggcggatcgtggaggac
gagcggtcgccggggcggcctgccgtgctgtgctccggcgagggcgtctacttcgtggag
gccgccgccaactgcaccctcgccgacgtcAACCACCTGGAGCGGCCGCTGCTGCTGTCC
AAGGAGGACCTCGTGCCGTGCCCGACGCCGGAGCAGTGGCCCGTCGAGCCGCACAACAGC
CTCGCCATGATCCAGGTGACGACGTTCACCTGCGGCGGCTTCGTGATCGGGCTGCGCACC
AACCACGCGGTGGCGGACGGCACCGGCGCCGCCCAGTTCATGAACGCCGTCGGCGACCTC
GCCCGCGGCCTCCCGGAGCCGCGGGTGAAGCCGATCTGGGCGCGCGACCGCTTCCCGGAC
CCGGACATCAAGCCCGGCCCGCTGCCGGAGCTCCCCGTGCTGCCGCTCCAGTACATCGCC
TTCGACTTCCCCGCCGCCTACCTCGGCAAGCTCAAGGCGCAGTACGCCGCCACCGCCGGC
GCCAGCAAGATCTGCTCCGCCTTCGACATCGTCATCGCCAAGCTCTGGCAGTGCCGGACG
CGCGCCATCGCCGCCGACCCCGCCGCGGCCGTCAAGCTCTGCTTCTTCGCCAGCGCCCGC
CAGGTGCTCGGCCTGGAGACCGGCTACTGGGGCAACGCCATCTTCCCGGTGAAGGTGTCC
GCGGCGGCGGGGGAGGTGGCGGCGTCGTCGGTGATCGAGCTCGTCGGCGTGGTCCGGGAG
GCGAAGCGGCGGATGGCCGGCGAGTGCCTGCGCTGGGCGGAGGGGCGCACCGGCGGCGCC
GACCCGTTCCAGATGACGTTCGACTACGAGTCCGTGTACGTGTCGGACTGGAGCAAGCTC
GGGTTCAACGACGTCGACTACGGGTACGGCGCGCCGTCGGCGGCGGGGCCGCTGGTGAAC
TGCGACCTCATCTCGTCGGTGATCGTCATGCGGGCGCCGGCGCCGCTCGCCGGCACGCGG
CTGCTGGCGAGCTGCGTCACCAAGGAGCACGCCGACGACTTCGCCGCCAGGATGAGGGAG
GATCTCGTCTAA

Protein

444 aa

>Os06t0594600-01 BAHD acyltransferase, Glucuronoarabinoxylan modification in grass cell wall
MGVFAVTKVSEGPVRPSAATPSETLPLAWVDRYPTHRGLVESVHIYLRRDDAAVEAPCAD
GGVIVEGKKKNNKPAAAVVRGALADALVHYYPFAGRIVEDERSPGRPAVLCSGEGVYFVE
AAANCTLADVNHLERPLLLSKEDLVPCPTPEQWPVEPHNSLAMIQVTTFTCGGFVIGLRT
NHAVADGTGAAQFMNAVGDLARGLPEPRVKPIWARDRFPDPDIKPGPLPELPVLPLQYIA
FDFPAAYLGKLKAQYAATAGASKICSAFDIVIAKLWQCRTRAIAADPAAAVKLCFFASAR
QVLGLETGYWGNAIFPVKVSAAAGEVAASSVIELVGVVREAKRRMAGECLRWAEGRTGGA
DPFQMTFDYESVYVSDWSKLGFNDVDYGYGAPSAAGPLVNCDLISSVIVMRAPAPLAGTR
LLASCVTKEHADDFAARMREDLV*

5'UTR

chr06:23381347..23381421 (- strand) : 75 bp

CDS

chr06:23380852..23381346 (- strand) : 495 bp

chr06:23379483..23380319 (- strand) : 837 bp

3'UTR

chr06:23379156..23379482 (- strand) : 327 bp

FASTA

>Os06t0594600-01 class=Sequence position=chr06:23379156..23381421 (- strand)
CCACACGCAC ACAGTTAGCT CTAGCTTTGC TTGATTTGCA GCAGCAGCAG CAGCAGCAGC AGCTAgcttg catccatggg
cgtcttcgcc gtcaccaagg tgtccgaggg ccccgtccgg ccgtccgcag cgacgccgtc ggagacgctg ccgctcgcct
gggtcgaccg ctacccgacg caccgcggcc tcgtcgagtc cgtgcacatc tacctccgcc gcgacgacgc cgccgtcgag
gcgccgtgcg ccgacggcgg cgtcatcgtc GAGGGAAAGA AGAAGAATAA TAAGCCGGCG GCGGCGGTGG TGCGCGgcgc
gctggcggac gcgctggtgc actactaccc gttcgcgggg cggatcgtgg aggacgagcg gtcgccgggg cggcctgccg
tgctgtgctc cggcgagggc gtctacttcg tggaggccgc cgccaactgc accctcgccg acgtcAACCA CCTGGAGCGG
CCGCTGCTGC TGTCCAAGGA GGACCTCGTG CCGTGCCCGA CGCCGGAGCA GTGGCCCGTC GAGCCGCACA ACAGCCTCGC
CATGATCCAG GTACATACGT GAATTAATAC TGCATTATTC CTGCTTGCTT TTTTTTTCTT TTTTCTTTTT GGCTTTCTAG
ATTTTGCTTT GCACTGTTGG ATCTCGTTAT GTTTTTCATG TGTCCTTGAA ATTGATATGG CAACAAGCAT GCGGCAGTTT
GAATCTATCA ATCAAACATG CACGTCAAAC TTAATTTCGT GAAAAGAAAA TTAAATTAAT ACTACTGCTA GCTCCTGTTG
TGCATTGTGA GTGTACTGCA CTTGATTAGT ACAGGAGTTA ACTGCATCTA CGACTCTAGT ACCAACGTGA TTGCAACACC
TAGCTAGATT AAAAATACCT TTTTCGTCTC CTTTGCCACG AATTTGAATT GATGTTTTAT TCTCATACCT ATACTATGTA
CTGGAGTACT CCTGAAAACC AGTGTAGCTT GCAGAAAAAA TGTCGAGGTC AAAACCTGGG TACAGAACCA AAAACAAAGC
AAAAAAATGA CGCGGACTCA TCAGTCAGTT GATTAATTAG TTGGAGGTCA CGTGATTTGC AGGTGACGAC GTTCACCTGC
GGCGGCTTCG TGATCGGGCT GCGCACCAAC CACGCGGTGG CGGACGGCAC CGGCGCCGCC CAGTTCATGA ACGCCGTCGG
CGACCTCGCC CGCGGCCTCC CGGAGCCGCG GGTGAAGCCG ATCTGGGCGC GCGACCGCTT CCCGGACCCG GACATCAAGC
CCGGCCCGCT GCCGGAGCTC CCCGTGCTGC CGCTCCAGTA CATCGCCTTC GACTTCCCCG CCGCCTACCT CGGCAAGCTC
AAGGCGCAGT ACGCCGCCAC CGCCGGCGCC AGCAAGATCT GCTCCGCCTT CGACATCGTC ATCGCCAAGC TCTGGCAGTG
CCGGACGCGC GCCATCGCCG CCGACCCCGC CGCGGCCGTC AAGCTCTGCT TCTTCGCCAG CGCCCGCCAG GTGCTCGGCC
TGGAGACCGG CTACTGGGGC AACGCCATCT TCCCGGTGAA GGTGTCCGCG GCGGCGGGGG AGGTGGCGGC GTCGTCGGTG
ATCGAGCTCG TCGGCGTGGT CCGGGAGGCG AAGCGGCGGA TGGCCGGCGA GTGCCTGCGC TGGGCGGAGG GGCGCACCGG
CGGCGCCGAC CCGTTCCAGA TGACGTTCGA CTACGAGTCC GTGTACGTGT CGGACTGGAG CAAGCTCGGG TTCAACGACG
TCGACTACGG GTACGGCGCG CCGTCGGCGG CGGGGCCGCT GGTGAACTGC GACCTCATCT CGTCGGTGAT CGTCATGCGG
GCGCCGGCGC CGCTCGCCGG CACGCGGCTG CTGGCGAGCT GCGTCACCAA GGAGCACGCC GACGACTTCG CCGCCAGGAT
GAGGGAGGAT CTCGTCTAAT ATACCATGGC CGCCCCCAAT AACATTATTA GTCACGTACA ATATTGTCAC TGAATATTAA
TTTGTTCGTG TATATCTATT GTGGTATGTA TTTTTTTTTT CATAGGAAAA AAGTAGTAGT ACGACAATAG GTAGCTGGGA
GCTACCTAAT ATCGACCTCT GGTTTGAGAG TAAGTGAGCG AGCGAGAGAT GTAAACCACC TCAGTTTTTA CCGTGCTTTG
TGACATGCGT GGTACAGTAC TGGTACTATT AATCATTGGC CGTGAAAAAT TATCTACCCA TATGCCACTG TATTTATGGT
TGTTTGTGGA GGATTACGTA TACTAA

Locus: Os06g0594600

Loading...

Locus: Os06g0594600

Loading...