Os06t0605600-01

Locus

Os06g0605600

Description

GAMYB-like protein, Flower development and stem elongation at the reproductive stage

RAP-DB Gene Symbol Synonym(s)

OsGAMYBL1

RAP-DB Gene Name Synonym(s)

GAMYB-like1, OsGAMYB-like1, GAMYB-LIKE 1

CGSNL Gene Symbol

GAMYBL1

CGSNL Gene Name

GAMYB-LIKE 1

Oryzabase Gene Symbol Synonym(s)

OsGAMYBL1

Oryzabase Gene Name Synonym(s)

GAMYB-like1

Transcript Evidence

AK106613 (truncated)

AB212075

Protein Evidence

Q3C253

Literature

PMID: 29162059

PMID: 16792694

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 27, 2017

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Homeobox-like domain superfamily (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Full-length cDNA

002-112-G09(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os06t0605600-01)

Others

Oryzabase (8710)

Transcript

2343 bp

>Os06t0605600-01 GAMYB-like protein, Flower development and stem elongation at the reproductive stage
ATGCCGCGCGCCGCCGCGCCGCACGGCGGTCTTTGCCTCTGCCGTCTCCGTCTCCGATCC
CGTCGCGCGCGCGTCGTGTTGAAGTTGCAGCAGCCAGCAATGCAGCCTGACTCGACTGAT
CGCCTCGCGGGCCGGCACGCAGGGTGCAGCGAGCGAGCGGCCGACATTTTATGTAAGCTT
CATCGGACAAAACAAATGATCGTTTTCAGGAAGTTCACCACTAAATCTAAGAAACACTCA
ATGCAGTCCTGTAAACCAAGGTTACACAGGTGGATCGTGCTCAATCCGAATGGCAAACCC
Tcaccatatactcttactttccaatttccttcgcgaacaccgacgcttgcacgcacacct
cgtgaagcccgttgcaaagatttcacccacacggtatccatccaccgtatgccatctcgt
atccaacttcgtcacccgTCTACTACTCTACTTCGCTCTCCGCCGCCGCCGCCGCCGCCG
CCGCCGCCCACCTCGTCTCGACGCCGGATGAGGATGGAGGGTTCGTCGCCGATGGAGGAG
GAGGAGGAGGCGGCGAGGCTGGCGGGCTCGCAGGGGGAGTCGCCGGCGATGCTGCACCCG
AACGGAGACGGAGACGGCGACGGCGGCGATGATGAGGGTGACGCCAGCGGCGGCGAAGAG
GAGCAGGGCGGTGTGGCTAGGGCGGGGGTTCGTCGCCGCGGCGGCGGCGGCCGTGTGCGC
GTGCGTGGCAGGATTCCGCTGAAGAAGGGGCCGTGGACGCCCGACGAGGACAAGCGGCTG
CGGGAGTACGTGGAGGCGCACGGCGAGGGGAACTGGAACCGGGTGCAGAGGAACGCGGGG
CTGAACCGCTGCGGCAAGAGCTGCCGCCTCCGCTGGGCGAACCACCTCAAGCCCGACCTC
AAGAAGGGGCCCTTCAGCAAGGAAGAGGAGGAGATGATCATCAAGCTCCATTTATGGCTG
GGGAACAAGTGGGCTAAGATGGCAAACTCTttgccaggccgcacagataatgaaatcaag
aacttctggaacaCTAGATGTAAGAGAATTCAGAGAACTGGTGAACCTCTATATCCGAAG
GAGTTTAATCATTTTAAGTTGACAGATCTGGAAGTGATGAACTGTGAAAGCCCTGATGAA
TCACGTGCCAAGAAACGAACAAATGAGGTTTTACAGGGAAATGGTCAAAGTTACAAAGAG
GTTTTTTTCGATAATTTAGACTATAGTAGACCAGAAAATTATATTCGGCCAAATTGTGTG
ACTCCAAATTCTCTTCCAGTTGATGCCACAAGTCCATTTGGTAGTGCCATTGCCACACAA
GATCAGTCAGTACCTTTTGGTAGTGCCATTGTCAGTGGACATCCAATTCTTGATGGCAAC
TTCTCTACTTCTGGGACCATACAGAGGCCCATGAATGTAGAGCTCCCTTCACTCCAATAT
CCCAACTATGACTTTAACAATAATAATGCATGGTCATATCACGACCCCTTAGGACATCCT
ATTGACCAGGTTGACTTTGGCTCCCTGAGATCAGAATATCTCTCTCCAAACAACAATGGT
CTGCTGGATGCATTGGTTCATGGAGGACATGGACAAGGGGAACTTGCAAATTCCCAAGGA
TCTTTTGATGCTTGTTTTCCTCGTGTTCAATGCAATCAAGTGATTCAATCGAATGCTTTC
TCTCTGAGTTCTTCCTTTCCAATCATTGGTGATGATCTCCTCGAGAACAGTTGTCATGCT
TTTGTTGGCATCAACAATAATGCAAGCAGCCTATTCCTTGACAGCCAACCTCCACCCTTG
GTGGACCCTACTTTCTGGAGGCACGATGTATCACTAGAACCGAATTTGCCAGTTTATTGC
CAGTTTAACGAAGAATTGCCGCCCTCAAATGAGCAGTTTGCCAAAGATGCAGATGACGCT
TTCGGTCATGGGGGTCTTTCTGATGAGACCAATCTAGCTGCTGCAGGTCAAGGCGATGAA
CATGACCTTGAGGACCCCTGGGCGAGCATGCCCGGTGCCTGTGACATACCTGATTTTCCA
AGTGAATGACTTGCATAGAGTTTGTGCGTGTTATTGATTTTGATCTCAACCAGTGAGAGA
ACCAAGAAGATCCTTTTTGCAATAACCATGCCTTTCAAGATCGTCCAATAAGTTTGTGGC
TGCGTATGCTATTACTATCTTACCGTGGAGTTGTGTGCTATATGCTTTGCTCCCCGAGGA
AATGTGGCCCTTGAACTGAATGTTGCCATTGTTTGTGTCGGCTACTTATTCGATTCATTA
ATGTTACATTGTTTGCTAGAATATGCTGAAATTGTATATTCGATTCATTGGTTTTGATTA
ATC

CDS

2049 bp

>Os06t0605600-01 GAMYB-like protein, Flower development and stem elongation at the reproductive stage
ATGCCGCGCGCCGCCGCGCCGCACGGCGGTCTTTGCCTCTGCCGTCTCCGTCTCCGATCC
CGTCGCGCGCGCGTCGTGTTGAAGTTGCAGCAGCCAGCAATGCAGCCTGACTCGACTGAT
CGCCTCGCGGGCCGGCACGCAGGGTGCAGCGAGCGAGCGGCCGACATTTTATGTAAGCTT
CATCGGACAAAACAAATGATCGTTTTCAGGAAGTTCACCACTAAATCTAAGAAACACTCA
ATGCAGTCCTGTAAACCAAGGTTACACAGGTGGATCGTGCTCAATCCGAATGGCAAACCC
Tcaccatatactcttactttccaatttccttcgcgaacaccgacgcttgcacgcacacct
cgtgaagcccgttgcaaagatttcacccacacggtatccatccaccgtatgccatctcgt
atccaacttcgtcacccgTCTACTACTCTACTTCGCTCTCCGCCGCCGCCGCCGCCGCCG
CCGCCGCCCACCTCGTCTCGACGCCGGATGAGGATGGAGGGTTCGTCGCCGATGGAGGAG
GAGGAGGAGGCGGCGAGGCTGGCGGGCTCGCAGGGGGAGTCGCCGGCGATGCTGCACCCG
AACGGAGACGGAGACGGCGACGGCGGCGATGATGAGGGTGACGCCAGCGGCGGCGAAGAG
GAGCAGGGCGGTGTGGCTAGGGCGGGGGTTCGTCGCCGCGGCGGCGGCGGCCGTGTGCGC
GTGCGTGGCAGGATTCCGCTGAAGAAGGGGCCGTGGACGCCCGACGAGGACAAGCGGCTG
CGGGAGTACGTGGAGGCGCACGGCGAGGGGAACTGGAACCGGGTGCAGAGGAACGCGGGG
CTGAACCGCTGCGGCAAGAGCTGCCGCCTCCGCTGGGCGAACCACCTCAAGCCCGACCTC
AAGAAGGGGCCCTTCAGCAAGGAAGAGGAGGAGATGATCATCAAGCTCCATTTATGGCTG
GGGAACAAGTGGGCTAAGATGGCAAACTCTttgccaggccgcacagataatgaaatcaag
aacttctggaacaCTAGATGTAAGAGAATTCAGAGAACTGGTGAACCTCTATATCCGAAG
GAGTTTAATCATTTTAAGTTGACAGATCTGGAAGTGATGAACTGTGAAAGCCCTGATGAA
TCACGTGCCAAGAAACGAACAAATGAGGTTTTACAGGGAAATGGTCAAAGTTACAAAGAG
GTTTTTTTCGATAATTTAGACTATAGTAGACCAGAAAATTATATTCGGCCAAATTGTGTG
ACTCCAAATTCTCTTCCAGTTGATGCCACAAGTCCATTTGGTAGTGCCATTGCCACACAA
GATCAGTCAGTACCTTTTGGTAGTGCCATTGTCAGTGGACATCCAATTCTTGATGGCAAC
TTCTCTACTTCTGGGACCATACAGAGGCCCATGAATGTAGAGCTCCCTTCACTCCAATAT
CCCAACTATGACTTTAACAATAATAATGCATGGTCATATCACGACCCCTTAGGACATCCT
ATTGACCAGGTTGACTTTGGCTCCCTGAGATCAGAATATCTCTCTCCAAACAACAATGGT
CTGCTGGATGCATTGGTTCATGGAGGACATGGACAAGGGGAACTTGCAAATTCCCAAGGA
TCTTTTGATGCTTGTTTTCCTCGTGTTCAATGCAATCAAGTGATTCAATCGAATGCTTTC
TCTCTGAGTTCTTCCTTTCCAATCATTGGTGATGATCTCCTCGAGAACAGTTGTCATGCT
TTTGTTGGCATCAACAATAATGCAAGCAGCCTATTCCTTGACAGCCAACCTCCACCCTTG
GTGGACCCTACTTTCTGGAGGCACGATGTATCACTAGAACCGAATTTGCCAGTTTATTGC
CAGTTTAACGAAGAATTGCCGCCCTCAAATGAGCAGTTTGCCAAAGATGCAGATGACGCT
TTCGGTCATGGGGGTCTTTCTGATGAGACCAATCTAGCTGCTGCAGGTCAAGGCGATGAA
CATGACCTTGAGGACCCCTGGGCGAGCATGCCCGGTGCCTGTGACATACCTGATTTTCCA
AGTGAATGA

Protein

683 aa

>Os06t0605600-01 GAMYB-like protein, Flower development and stem elongation at the reproductive stage
MPRAAAPHGGLCLCRLRLRSRRARVVLKLQQPAMQPDSTDRLAGRHAGCSERAADILCKL
HRTKQMIVFRKFTTKSKKHSMQSCKPRLHRWIVLNPNGKPSPYTLTFQFPSRTPTLARTP
REARCKDFTHTVSIHRMPSRIQLRHPSTTLLRSPPPPPPPPPPTSSRRRMRMEGSSPMEE
EEEAARLAGSQGESPAMLHPNGDGDGDGGDDEGDASGGEEEQGGVARAGVRRRGGGGRVR
VRGRIPLKKGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHLKPDL
KKGPFSKEEEEMIIKLHLWLGNKWAKMANSLPGRTDNEIKNFWNTRCKRIQRTGEPLYPK
EFNHFKLTDLEVMNCESPDESRAKKRTNEVLQGNGQSYKEVFFDNLDYSRPENYIRPNCV
TPNSLPVDATSPFGSAIATQDQSVPFGSAIVSGHPILDGNFSTSGTIQRPMNVELPSLQY
PNYDFNNNNAWSYHDPLGHPIDQVDFGSLRSEYLSPNNNGLLDALVHGGHGQGELANSQG
SFDACFPRVQCNQVIQSNAFSLSSSFPIIGDDLLENSCHAFVGINNNASSLFLDSQPPPL
VDPTFWRHDVSLEPNLPVYCQFNEELPPSNEQFAKDADDAFGHGGLSDETNLAAAGQGDE
HDLEDPWASMPGACDIPDFPSE*

CDS

chr06:24012144..24012308 (- strand) : 165 bp

chr06:24011665..24011800 (- strand) : 136 bp

chr06:24010655..24010791 (- strand) : 137 bp

chr06:24009957..24010024 (- strand) : 68 bp

chr06:24009317..24009800 (- strand) : 484 bp

chr06:24005846..24006584 (- strand) : 739 bp

chr06:24005460..24005779 (- strand) : 320 bp

3'UTR

chr06:24005166..24005459 (- strand) : 294 bp

FASTA

>Os06t0605600-01 class=Sequence position=chr06:24005166..24012308 (- strand)
ATGCCGCGCG CCGCCGCGCC GCACGGCGGT CTTTGCCTCT GCCGTCTCCG TCTCCGATCC CGTCGCGCGC GCGTCGTGTT
GAAGTTGCAG CAGCCAGCAA TGCAGCCTGA CTCGACTGAT CGCCTCGCGG GCCGGCACGC AGGGTGCAGC GAGCGAGCGG
CCGACGTGCG TGCATGCGCC AACCTCAAAC TACTTGAAAT TTGAAAAGCA TATGCACGCA TTATGCCTTT TTTATTTGCC
CCCTTTCGCT TTGGGCTTTC AGTAATTATT CATGTACTTA CTTCTTACGT CTCATAATAA ATTTATTTTT AATCCATTTT
ATTTGTAGAA ATGAATACTA TAGGAATACC ACTGGCAGAA AAGGATGTGA ATCAACAACA AGCTGTGACA TTACCGTGAT
ATATCCATAG ACTTCCATAA ATGTGCACAC CGCTTGACAA ACAGATAATC TGTTTCGAAT GGCTTCACGG GAAACAACAC
AAATGCGAGG TTTATTATTG CATCCTAGAT TTTATGTAAG CTTCATCGGA CAAAACAAAT GATCGTTTTC AGGAAGTTCA
CCACTAAATC TAAGAAACAC TCAATGCAGT CCTGTAAACC AAGGTTACAC AGGTGGATCG TGCTCAATCC GAATGGCAAA
CCCTGTATGG TACCCACTAT CGAAATGAAA AACGTCACCC CATCGTTACA AGTTAACCAA TTTTTTTAAC CGATAATCAG
CAGTAAAAAA AACTTCCATT CGAAATACCT TTCTAAAATT TTTTGTAGCG GGCCAGCAGT TAGTTCCACC TTTTCAGTGC
TGATTTGAAT TTTTTGGCCC GCTCCGATAT AAGGGTGTTA CACGTACGTT TGCTTGTGCA CATAATAATC GTTAGTAATT
CATTCGTTTG CACATGGATG TACAGCTATC TAGCGAGTTG CGCTGTTGCG TTCCACTGTC ACGCAAATTG GCAACCAGGC
AAAATTCGGG GATCGAATCA AATAGGACGT GTGTGCTTCA TGCCTTCATC CAATGGTGGC TGCCCTGCTG GTTGGTGGTA
CAGTGAAGCG CGCTGGTGCA TGATTTTAGG ATGTGAGCAT TATGCAGTGC ATAATTAATT AAGTActccc tccatcaact
tttgatagtc atatttcatc ttggcacaAT GAGGtgtgtt cggcaccctc tttttctaac ccctctcgat cgttttccgt
gcgcacactt ttcaaaccgc taaacggtgt attttttgta aaaaaatttt tgtacaaaag ttgcttaaaa aaTTGTAATT
CTCACAAACT CTCCGAAACC TGCAGCCACA GCCGGCCACA GAAAAttcac cgagtcagac tcggcttgcc ttgccacatg
cccaggccag ccgacgccct gcttgcatca ccaagccgag ccgctgcatg ctgcacagta cgcatacaca catgcatagc
acaacatgca tcaccacgct actgcaattc atagtaggca cacatatatg catgctacag taccacgtgt actgtagcac
catatactct tactttccaa tttccttcgc gaacaccgac gcttgcacgc acacctcgtg aagcccgttg caaagatttc
acccacacgg tatccatcca ccgtatgcca tctcgtatcc aacttcgtca cccggtatcc ttgaccgtct ggacctcaac
tcctcactga gtctagAACT tcaattctcc ccttttcaag aagtatgcat tttgtatatt tctccccctt tgacaataat
ttcatcaaga tgtaagttat aaaaatctaa atacacccat agcatgaccc atcaatattA ATAATTAAGA ATTTAGCAAG
AAAATGTTGA CACATCTAGC TTTTTCCTAA CTATTGAAGT TACCAAAAAT TCAGTAGGAC ACGTGTTGGC TTCAATTCAA
AACAACCTTA ATATGAGAGA ACGTACCTAA CATTAATTTC AGCACGCGGA ATATATATCC TTTGTTTCTT TTAAATACTA
AGATATCTTT TCCACGTTTC ATCCATGGAA TTTAATATTA AATACATATA TCCTTTTTTT AAAACATTAT CCTATCTGAA
TGGATATATA ATAATTCTTC CATGGATAAA ATAAACAAGA GGGTTTGATA TTTTTTTCCT ATAAAAAAAT TACATGATAA
ACCTTAGTAA CGAAGCAAAC CCTAGTTGGG CCGCCTCGAG ATGGCAGCCC ATTCCGGCCC AGGACACGAG CCATCGTCAT
CGGGGGTCGT CTACTACTTG CTTCCTCCTC CCTACTCCGC CTAGTCTACT ACTCTACTTC GCTCTCCGCC GCCGCCGCCG
CCGCCGCCGC CGCCCACCTC GTCTCGACGC CGGTGAGCAC TCTCCCCCGC TGGAGATCCA CGCGCCGCTG GTTGGATTAG
TTCGGGCTAG GGTGGAGCGA GATTGGATCG TTGGATATTT GGTTTTTGGT TTTTGATTTT TTTTTTGTTG AATTGTTGGG
GGGATTTGAC TGGATTTTCC TCGTGCAGGA TGAGGATGGA GGGTTCGTCG CCGATGGAGG AGGAGGAGGA GGCGGCGAGG
CTGGCGGGCT CGCAGGGGGA GTCGCCGGCG ATGCTGCACC CGAACGGAGA CGGAGACGGC GACGGCGGCG ATGATGAGGG
TGACGCCAGC GGCGGCGAAG AGGAGCAGGG CGGTGTGGCT AGGGCGGGGG TTCGTCGCCG CGGCGGCGGC GGCCGTGTGC
GCGTGCGTGG CAGGATTCCG CTGAAGAAGG GGCCGTGGAC GCCCGACGAG GACAAGCGGC TGCGGGAGTA CGTGGAGGCG
CACGGCGAGG GGAACTGGAA CCGGGTGCAG AGGAACGCGG GGCTGAACCG CTGCGGCAAG AGCTGCCGCC TCCGCTGGGC
GAACCACCTC AAGCCCGACC TCAAGAAGGG GCCCTTCAGC AAGGAAGAGG AGGAGATGAT CATCAAGCTC CATTTATGGC
TGGGGAACAA GTGGGCTAAG ATGGCAAACT CTGTAAGTGT GCTCCTCCTC CTACTCTTTC ATGGTTCCTT GGTTTTGCTA
GCTTGTGCAT TGATACTCCG TTCATTGTTA GTTTAGATTA GTAGCATGCT TAATATTTAG GTGCATTGGT GTATTAGTTG
GATTAGAGCA AAAATATTTA ACCACCTAAA TTAAAGCCTA CCAACAGTTT GCCTAGTGGG GAGAATGCAT GCTGTCCACT
CCAAATATAG GGGCCGCAAA TATACCACTT GCTCGTAGAT AGATGTATTC AGAGTACATC AACCAGTATT TTCTTCTGTA
TTGGCGAAAG ACTTTATTTT ATTCATTTAA TTGGCTCCAA CTTGATTTAA ATAGAGAATG GCCACTGGGC ATACTTTTTT
CTGAGTGTGG CGTAGTGCCA TGGTGCAGAC ACATTTGACA TGCTGCACTC TTGTAAATGG CCTTGTTAAA AGGAGTAGAC
AAATGCTTTG CCATTATTCC TTGTTTGCAG AGAATAACAA AGTAAGTCGT TCTTTTACAA TTGTTGTTAG TCTTGTCTGA
AATAGTATTT GGTCCTCCAA CAAATCGAAA GAAAATTGAT TCAGACCAAT TATCCTTTAA ATCTTCTTGC TTGTAGTGGC
TTTACATAAG CAGGGGCAGA GCCTCATGGC TGCCTACCTG GACACTGGCC TCCATTGGCT GCAAAACCTT TGCAAGTTAC
AACTTAGTCG TATATATACT ACCTATCTAG AAGCATGATA TACTGCTTGA TTAATATAAA TTGTTTAGTT TATAATCAGA
ACAAACGGCA TATTGTCAGT CGAGTATCCG TAGAAAACCA AACAGCGTAT CTAAACTGTT TTTTAACTTT GATTTGATGC
GATACCCGTG AACAAAATTC AGCTAAGCTT TGGCCTTCTA TGAATTAAGT AGACCCAATC CTCCATGTTG GACGTAAGCT
GTCTGTTCAA TTCTGGATTG TCGTGGCTCG AGAATTTTGT AGATAATGGA TAGAAATTCG GCATCTGTAG ACTGTAGTCA
CTGTTCTAGG TTCCTATTAG GATCATTGTT TGTTAGTATT GTTACTACAT GAAAATCGGT GTGATCGAGG CTATATATCT
TTCATCTTCT GAATCTTTAG GGACAGCATT ACTGGTGTGA TGTGAGTGCC TGAGTGAGTG AGAGTGAGAG TGTGTCCTAG
TTGCGGACTG AACACATAAA GAATTTGCAA AAGTTAACAA TCGTTTTCTC CATATTGCAT CACGATATCA CATCACTAAT
TCACTATTTG TTGGTGGTTT GTACTACGCA TTTGCAAACA CCACGTAGCT AGCTAGATCA AGCTAGATAT AACACCAAAT
CTGAGTTCTA TCCTGAAGAC TAGCTAGTAA TCAATCGACT TAATTAGGAT ATAACGTGAA AATCGATCTT TGGCTGCCGT
TTGTGTCAAG TTAACCATTC ATTAGCTTAA GTGAATGGTT TTACTTTTCT TTTCAGAAAC GATACTGTCA TCAGGTGAAA
CTGCAACTAA TATTGATGGT GAAGTCTGAA CTCTGAAATG GATGGTGAAA TACTGAAATT AATGGAAGAG TGAATAGTTT
ACCTGACAAC CAGATGAGGT CGGCGAGGTC GAGACCCTTG CTCTGGATAT AATCTATTAA TCAAGCAGTA TATAATCTAT
TAATCATGTA TCCGTAGAAT AGCTCTCGAG GTGTGGTCCC GAGAATAGCA GTCGAGTATC CGTAGAAAAC CAAACGGCAT
ATTGCAATCA TGTATCTGAT ATTTAGATGC ATTGGTGTAT TGGATTAGAG GAAAATATTG TCTCTAGATT AAAGCCAGCT
AACAGTTTGT CTAGTGCAGT CTTCTCCATA TATACTATTT GCTAGTGTCT GGATATAATC AGTGGACATT AAATAGTTCT
TTCTTATGTA TATTGGTGAC AGACTTTATT TTATTCAATT TAATTGTCTT AATATCGTTA GTTGCTAAGG ACTTAAATAG
AGAATGGTTG CCGGGCATAC TTTTTCTTTA GTGCGTTGTG GTGCCATGGG GCACACGTGC TTGCAGTGCT GCACTGCAGA
AAAGAAACTA GATATATATT TTACTGTTAT TCCTCTTCTG TAGAGAAGGA ACTCGGCTTG TTTGAGCATT CAGAGCTTGC
ACTAATTAGA AAAAAATAGA ATACCTATTT TCTTGAATCT ATACAGTCAG TTAACACATG GAACTGTCTT TTTCCCTTGT
GTTACTGTAA GCAGGCGGAT GTACTGTGAC TCGCTAGCTA GACACAATCT CGAAAGATGT GAATTTAATT TTCAATTCTT
AGTTTTCTGA GCCATGTTAT AAGTAGTGTC AACTTTTAAA CTGCAACAGG AAAAGCTGAC ATCTAGGCCA CAGGATAAGG
TAGGGTCTGC AATTATTATG GGAGGATTCA TTGACATGGT CATATATATT TTTAAACTTT TATTGGGTTC CTTTCCTGCC
TCCTACTAAA TTCCTATGAG TTTTTGTTCA TCGAATAGGA CTTCATCATA TTTTCATTTA TGTAAAGACA ATATCATTCA
CTGTTTCGTT AGGTATGTTT AAATCCTCTC CAACTATTGC AACACCATGA TACATCTTGC TATATTTGCC ATTCTAACAT
CTGAGGTACA ATGCAAATGC TTATTAGGCT AATGCCTTAA GGTTCTTTAG TCTAATTGCC TAGAAAAATC CTATTAGATC
ATATGTTAAC TTGCATATCT GAACTTCTGT TGTTGTTatt gcagttgcca ggccgcacag ataatgaaat caagaacttc
tggaacaCTA GATGTAAGAG AATTCAGAGA ACTGGTGAAC CTCTATATCC GAAGGAGTTT AATCATTTTA AGTTGACAGA
TCTGGAAGTG ATGAACTGTG AAAGCCCTGA TGAATCACGT GCCAAGAAAC GAACAAATGA GGTTTTACAG GGAAATGGTC
AAAGTTACAA AGAGGTTTTT TTCGATAATT TAGACTATAG TAGACCAGAA AATTATATTC GGCCAAATTG TGTGACTCCA
AATTCTCTTC CAGTTGATGC CACAAGTCCA TTTGGTAGTG CCATTGCCAC ACAAGATCAG TCAGTACCTT TTGGTAGTGC
CATTGTCAGT GGACATCCAA TTCTTGATGG CAACTTCTCT ACTTCTGGGA CCATACAGAG GCCCATGAAT GTAGAGCTCC
CTTCACTCCA ATATCCCAAC TATGACTTTA ACAATAATAA TGCATGGTCA TATCACGACC CCTTAGGACA TCCTATTGAC
CAGGTTGACT TTGGCTCCCT GAGATCAGAA TATCTCTCTC CAAACAACAA TGGTCTGCTG GATGCATTGG TTCATGGAGG
ACATGGACAA GGGGAACTTG CAAATTCCCA AGGATCTTTT GATGCTTGTT TTCCTCGTGT TCAATGCAAT CAAGTGATTC
AATCGAATGC TTTCTCTCTG AGTTCTTCCT TTCCAATCAT TGGTGATGAT CTCCTCGAGA ACAGTAAGTG TACTCACTCT
TATTTTAACA TGAACAATAT CACATAAAAC TTACTGTTAG TCTTTTCAGG TTGTCATGCT TTTGTTGGCA TCAACAATAA
TGCAAGCAGC CTATTCCTTG ACAGCCAACC TCCACCCTTG GTGGACCCTA CTTTCTGGAG GCACGATGTA TCACTAGAAC
CGAATTTGCC AGTTTATTGC CAGTTTAACG AAGAATTGCC GCCCTCAAAT GAGCAGTTTG CCAAAGATGC AGATGACGCT
TTCGGTCATG GGGGTCTTTC TGATGAGACC AATCTAGCTG CTGCAGGTCA AGGCGATGAA CATGACCTTG AGGACCCCTG
GGCGAGCATG CCCGGTGCCT GTGACATACC TGATTTTCCA AGTGAATGAC TTGCATAGAG TTTGTGCGTG TTATTGATTT
TGATCTCAAC CAGTGAGAGA ACCAAGAAGA TCCTTTTTGC AATAACCATG CCTTTCAAGA TCGTCCAATA AGTTTGTGGC
TGCGTATGCT ATTACTATCT TACCGTGGAG TTGTGTGCTA TATGCTTTGC TCCCCGAGGA AATGTGGCCC TTGAACTGAA
TGTTGCCATT GTTTGTGTCG GCTACTTATT CGATTCATTA ATGTTACATT GTTTGCTAGA ATATGCTGAA ATTGTATATT
CGATTCATTG GTTTTGATTA ATC

Locus: Os06g0605600

Loading...

Locus: Os06g0605600

Loading...