Os06t0607900-01

Locus

Os06g0607900

Description

GRAM domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

OSNOP

CGSNL Gene Name

NO POLLEN

Oryzabase Gene Symbol Synonym(s)

Osnop, nop

Oryzabase Gene Name Synonym(s)

no pollen gene, no pollen, C2 and GRAM domain containing protein; Osnop

Transcript Evidence

AK070879 (DDBJ, Best hit)

Protein Evidence

C0J9X6 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

GRAM (IPR004182)

Full-length cDNA

J023065L10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0607900-01)

RiceXPro (AK070879)

Others

Oryzabase (6242)

KEGG (Os06t0607900-01)

Transcript

1498 bp

>Os06t0607900-01 GRAM domain containing protein.
AAGTGCGATCAAACTAGCAACCCTAAGATACACTTGAGAATATTTTTAAATAACTCGAGA
GGAACTGAAGTTGTTATGAACTACCTGGCAAAGATGCGGAAAGAAGTTGGCAAGAAGATA
AATTTGCGGTCTGCCCAAACAAATGCAGCATTTCGGAAACTCTTTAACCTCCCACCGGAA
GAGTTTCTCATCGATGATTTTACCTGCCATCTAAAACGAAAGATGCCACTTCAGGGGCGC
CTCTTCTTTTCACCAAGAATTATTGGATTTTATTCCAACATATTTGGTCACAAGACCAAG
TTTTTCTTTTTGTGGGATGATGTTGACGATATCCAAGTTATCCCTCCCACCCTGTCAATT
GGTAGCCCATCCTTGACGATCATCCTCCGAAAGGGTAGAGGTTTAGAAGCAAAACATGGT
GCCAAGGGAACAGATCCTAATGGAAGACTCAAATACTATTTTCAGTCCTTTGTTTCATTC
AATGATGCCCATAGAATAATCATGGCAATTTGGAAAATGCGATCACTGAGTCCAGAACAG
CAGGGGGATATGATCGAAAAAGAGTCCGATACCAAAGAACTCCAGCTCGAAGAAGGTGGA
ACCTTATTTACCCATGAAGATGTCAAAATGTCTGAAATATTCTCATCGGCCCTCTCTGTT
GATGTCGAGTCCCTGATGGAGATGTTTTCAGGAGGGCCTTTGGAACACAGAATGATGCAA
AAAGCTGGTTGTATTGACTACTCGCCAACAGAATGGGAACTTGTAAGCCGAAATATATAC
CAGCGGCAAATCAGCTACAAGTTTGACAAAAACTTGTCAAGATATGGAGGAGAAGCAACC
ACCACTCAGCAGAGGTATGCCCTAGTGAACCAAGAAGGCTGGGCCATTGAAGAGGTGATG
AGCCTACAAGGTGTTCTACTGGGGGACTGCTTCAATGTTCAGATGAAGTACACTGTGGTG
AATGTACCGTCAAAACCGAACACTTGCAGTGTGCAGGTTTTGTTGGGGATAGCCTGGTTA
AAGAGCACTAAGCAACAAAAGAAGATCACGAAGAGTGTCATTTCCAATTCATCCATTAGA
TTGAAGGAGCTCTTTGCTGAAGTAGAGAAGGATCTTACATCGAGAAGCGGGGCAAGCTGA
CATCTGCACAAACTAACAGTAGATTGTTCATTGCAACAACCAAATGTGTTTGAAGAGACC
AGTATACATGGAGCAATTTGGGAGAACTGTGGCTGTTTGCCTGCGGTTGACTGGTTTCAG
CTTTGTCAACATTCTTGCTGGTAGAGTTAATACACAGATGGCAAAGCCAAAAAAAGAAAA
AGAAAAAAAAAAGAAGTGTGACATCAATGTGAATAGATTGTTCAAAAACACTTTTTTTCT
TAAACATTCCTGATATGATCTTACCTTCATAGGAAGTGAAGTAGAGTTGTATACTTGTAT
ATGCACAGCTGACCAATGTTATACAAACGATATAGTAAAAGGAATCTAACTTTGATTC

CDS

1065 bp

>Os06t0607900-01 GRAM domain containing protein.
ATGAACTACCTGGCAAAGATGCGGAAAGAAGTTGGCAAGAAGATAAATTTGCGGTCTGCC
CAAACAAATGCAGCATTTCGGAAACTCTTTAACCTCCCACCGGAAGAGTTTCTCATCGAT
GATTTTACCTGCCATCTAAAACGAAAGATGCCACTTCAGGGGCGCCTCTTCTTTTCACCA
AGAATTATTGGATTTTATTCCAACATATTTGGTCACAAGACCAAGTTTTTCTTTTTGTGG
GATGATGTTGACGATATCCAAGTTATCCCTCCCACCCTGTCAATTGGTAGCCCATCCTTG
ACGATCATCCTCCGAAAGGGTAGAGGTTTAGAAGCAAAACATGGTGCCAAGGGAACAGAT
CCTAATGGAAGACTCAAATACTATTTTCAGTCCTTTGTTTCATTCAATGATGCCCATAGA
ATAATCATGGCAATTTGGAAAATGCGATCACTGAGTCCAGAACAGCAGGGGGATATGATC
GAAAAAGAGTCCGATACCAAAGAACTCCAGCTCGAAGAAGGTGGAACCTTATTTACCCAT
GAAGATGTCAAAATGTCTGAAATATTCTCATCGGCCCTCTCTGTTGATGTCGAGTCCCTG
ATGGAGATGTTTTCAGGAGGGCCTTTGGAACACAGAATGATGCAAAAAGCTGGTTGTATT
GACTACTCGCCAACAGAATGGGAACTTGTAAGCCGAAATATATACCAGCGGCAAATCAGC
TACAAGTTTGACAAAAACTTGTCAAGATATGGAGGAGAAGCAACCACCACTCAGCAGAGG
TATGCCCTAGTGAACCAAGAAGGCTGGGCCATTGAAGAGGTGATGAGCCTACAAGGTGTT
CTACTGGGGGACTGCTTCAATGTTCAGATGAAGTACACTGTGGTGAATGTACCGTCAAAA
CCGAACACTTGCAGTGTGCAGGTTTTGTTGGGGATAGCCTGGTTAAAGAGCACTAAGCAA
CAAAAGAAGATCACGAAGAGTGTCATTTCCAATTCATCCATTAGATTGAAGGAGCTCTTT
GCTGAAGTAGAGAAGGATCTTACATCGAGAAGCGGGGCAAGCTGA

Protein

355 aa

>Os06t0607900-01 GRAM domain containing protein.
MNYLAKMRKEVGKKINLRSAQTNAAFRKLFNLPPEEFLIDDFTCHLKRKMPLQGRLFFSP
RIIGFYSNIFGHKTKFFFLWDDVDDIQVIPPTLSIGSPSLTIILRKGRGLEAKHGAKGTD
PNGRLKYYFQSFVSFNDAHRIIMAIWKMRSLSPEQQGDMIEKESDTKELQLEEGGTLFTH
EDVKMSEIFSSALSVDVESLMEMFSGGPLEHRMMQKAGCIDYSPTEWELVSRNIYQRQIS
YKFDKNLSRYGGEATTTQQRYALVNQEGWAIEEVMSLQGVLLGDCFNVQMKYTVVNVPSK
PNTCSVQVLLGIAWLKSTKQQKKITKSVISNSSIRLKELFAEVEKDLTSRSGAS*

5'UTR

chr06:24189866..24189940 (+ strand) : 75 bp

CDS

chr06:24189941..24189982 (+ strand) : 42 bp

chr06:24190064..24190180 (+ strand) : 117 bp

chr06:24190469..24190728 (+ strand) : 260 bp

chr06:24191173..24191341 (+ strand) : 169 bp

chr06:24191448..24191720 (+ strand) : 273 bp

chr06:24191903..24192095 (+ strand) : 193 bp

chr06:24192565..24192575 (+ strand) : 11 bp

3'UTR

chr06:24192576..24192933 (+ strand) : 358 bp

FASTA

>Os06t0607900-01 class=Sequence position=chr06:24189866..24192933 (+ strand)
AAGTGCGATC AAACTAGCAA CCCTAAGATA CACTTGAGAA TATTTTTAAA TAACTCGAGA GGAACTGAAG TTGTTATGAA
CTACCTGGCA AAGATGCGGA AAGAAGTTGG CAAGAAGGTA TCGAATTGAG CAGCTCTTTT GTTGGCCTTT TTCGCCATCA
CTTGTTCTAT TTCTATAATG ACAGAACAAA TCATGCAGAT AAATTTGCGG TCTGCCCAAA CAAATGCAGC ATTTCGGAAA
CTCTTTAACC TCCCACCGGA AGAGTTTCTC ATCGATGATT TTACCTGCCA TCTAAAACGA AAGATGCCAC TTCAGGTTGG
GCTTTCCTAC TCTAGCAATT CTTTTAAAGA GAACAAAAAT TTCCGAATGC TTCTTTTCAT GTGTGCAGTT TGCTATTATT
GAGCTTTCAT ACATAGTGTA TTCATAATAT GCATATTGTC TAGCATAATA GCCATAGGAC TTAGACATTA CAAGAAAGAG
GACTAGTACA ATTTTGTACA TCGAGGATTT ATAGTGTTGA TTGGTTTTTG AAATTTGACT TTATTTGTAT GTCAACCATT
TTTCTGTCAA AGTTTGAGAA TATTGAGATC CTTACTTTTA CAGGGGCGCC TCTTCTTTTC ACCAAGAATT ATTGGATTTT
ATTCCAACAT ATTTGGTCAC AAGACCAAGT TTTTCTTTTT GTGGGATGAT GTTGACGATA TCCAAGTTAT CCCTCCCACC
CTGTCAATTG GTAGCCCATC CTTGACGATC ATCCTCCGAA AGGGTAGAGG TTTAGAAGCA AAACATGGTG CCAAGGGAAC
AGATCCTAAT GGAAGACTCA AATACTATTT TCAGTCCTTT GTTTCATTCA ATGATGCCCA TAGGTAATTT ACATTTGTTT
CTCTTTCTAA AGTTTAACAG GACATCTTGT ACAGGGATAT GCTTTATTGT TTAAATCTTG TCTTTAGCTC CAGATTAATA
TGTTCACAGG CAGCCGAGCC TGATAAATTG GGTCTGGCTG GACTGAGGCT TTGAGTTTTC TAATCCACAA GACTGATACC
TGCCTGGCCT GAAAAAGAAA AGTTAAATAT GAATTTATGG GGAGTATTTT TCAGGCTTCT TCATGTGGTA GTGAAGGTTG
TAGGGAGGCA CCAGACTCAG ATCTAGAAGA TAGGCAGTCT TTTCTTACAC TTTTTGGGAA GCCTGACAAT AAGTCATATT
ATGCACGAAC CTACAAATAA GCAACGTTGT AAAACTGATT TTTTTATTAC ACAACTAGCA AGCAGGCTCC TAATTTGGAT
TAATTTTGTT CCATTTTTTC CTGACAGAAT AATCATGGCA ATTTGGAAAA TGCGATCACT GAGTCCAGAA CAGCAGGGGG
ATATGATCGA AAAAGAGTCC GATACCAAAG AACTCCAGCT CGAAGAAGGT GGAACCTTAT TTACCCATGA AGATGTCAAA
ATGTCTGAAA TATTCTCATC GGCCCTCTCT GTTGATGTGA GTGTTTTTAC CTTTGCAAGC TCATGCTTGA GCTTGACACG
ATGCGTTTTC GCAACATATA ATCTGTTTTG AGCTCCCTAC GAATGAATGT TTGCATTTAC AGGTCGAGTC CCTGATGGAG
ATGTTTTCAG GAGGGCCTTT GGAACACAGA ATGATGCAAA AAGCTGGTTG TATTGACTAC TCGCCAACAG AATGGGAACT
TGTAAGCCGA AATATATACC AGCGGCAAAT CAGCTACAAG TTTGACAAAA ACTTGTCAAG ATATGGAGGA GAAGCAACCA
CCACTCAGCA GAGGTATGCC CTAGTGAACC AAGAAGGCTG GGCCATTGAA GAGGTGATGA GCCTACAAGG TGTTCTACTG
GGGGACTGCT TCAATGTAAG ATGTCCCTTC ATGCATCTCT TACTCTGCGT TGTAATTTTT TAATTCAAAA TTTATCAAGA
TTCTGAAGCT ATGGTGTTGG AAATATAATA TGAGTTAGAC ATCACCAGCT TGTGTTTTCT TTGAATTGTT CTTGCTTAAC
TAGCCCTTAA CAAATATCAA TGATTCTTAA TTTGCAGGTT CAGATGAAGT ACACTGTGGT GAATGTACCG TCAAAACCGA
ACACTTGCAG TGTGCAGGTT TTGTTGGGGA TAGCCTGGTT AAAGAGCACT AAGCAACAAA AGAAGATCAC GAAGAGTGTC
ATTTCCAATT CATCCATTAG ATTGAAGGAG CTCTTTGCTG AAGTAGAGAA GGATCTTACA TCGAGAAGCG GTAGTATTTT
CAACCCAGAT TTGGAACTGA ACCCATACTA TTGCTTAATG TTTTAGTTAT CACATAAATT AATTACAAAA TCCACATAAT
TCTTTTTCAA AAAAAAACAA AATCTAAATA AAAAAATCAA TTCAAGCCTG CCAGGATTGA CCTAACATGA AATCTCCCAG
GTAGCAAACC TATATATTGT TTTACGGTTT GTCACAACCA TTCAAATTAA TTATTACTTC ATTCGTCCCA AAATTTTGCC
ACAACACATC CTACTAGGAT GTATCGTATT CAGCACTAGG TAGCAATATT TGGGGATGGA GGTAATACCA CATAATTTGG
CTAGGTATTA AATAGATTAA TCTGATTTAA ATTTTGACTG CCTTGTTACA AACAAACATC TTTCCTTGAG ACTACAAACC
AATGCTGTTT ATTTTATCTT GGGCAACTAT ACTGATTTGT CTTTCTGCAA CGTTTTCAGG GGCAAGCTGA CATCTGCACA
AACTAACAGT AGATTGTTCA TTGCAACAAC CAAATGTGTT TGAAGAGACC AGTATACATG GAGCAATTTG GGAGAACTGT
GGCTGTTTGC CTGCGGTTGA CTGGTTTCAG CTTTGTCAAC ATTCTTGCTG GTAGAGTTAA TACACAGATG GCAAAGCCAA
AAAAAGAAAA AGAAAAAAAA AAGAAGTGTG ACATCAATGT GAATAGATTG TTCAAAAACA CTTTTTTTCT TAAACATTCC
TGATATGATC TTACCTTCAT AGGAAGTGAA GTAGAGTTGT ATACTTGTAT ATGCACAGCT GACCAATGTT ATACAAACGA
TATAGTAAAA GGAATCTAAC TTTGATTC

Locus: Os06g0607900

Loading...

Locus: Os06g0607900

Loading...