Os06t0613400-01

Locus

Os06g0613400

Description

COM1/SAE2 homolog, Homologous chromosome synapsis and recombination in meiosis

RAP-DB Gene Symbol Synonym(s)

OsCOM1

RAP-DB Gene Name Synonym(s)

Completion of Meiosis 1, COM1/SAE2 homolog

CGSNL Gene Symbol

COM1

CGSNL Gene Name

COMPLETION OF MEIOSIS 1

Oryzabase Gene Symbol Synonym(s)

OsCOM1

Oryzabase Gene Name Synonym(s)

Completion of Meiosis 1, completion of meiotic recombination 1, COM1/SAE2 homolog

Transcript Evidence

AK119314

Protein Evidence

B9FU48

Literature

PMID: 22507309

Note

  • Exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

March 5, 2015

Gene Ontology (GO)

Biological Process: DNA damage checkpoint (GO:0000077)

Biological Process: DNA repair (GO:0006281)

Molecular Function: single-stranded DNA endodeoxyribonuclease activity (GO:0000014)

Functional domain (InterPro)

Com1/Ctip family (IPR013882)

Full-length cDNA

001-130-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0613400-01)

Others

Oryzabase (10421)

Transcript

2219 bp

>Os06t0613400-01 COM1/SAE2 homolog, Homologous chromosome synapsis and recombination in meiosis
GAAAAGCTTTCTCCCCCATTTCAAGCGGCGCGAACGGCGGCGGCGGCCGGCGAGGAGGGC
GACGGCTAGGGTTTTTCTCTCTCTCCGCCGCCGAAATCGAATCCCCGAGGTGAGCTCCAT
CTCATACCCACCGAGTCTCACCGTCCCGACCCATCTCCTTCACCCGCCGCCGCCGCCTGC
GCTGCCCCGCCGATCACCGTGAGCTGCTGCAGCTTCCGCCTCCGAGATGAATGCGAATGT
GTTGGGCGGCGATGTGGTGGCGGACGATTTCAACTACTTCTCCGGTGTGAGCACCATCTT
TGTGGCCAACATCCAGGAGGTGAAGGACCGGGTTTCCCAGATCGAGCTCCTCTTCTGCAG
CCAGCTCTTCCCTCATGTCCAGGCCATGTGGAAGGCGGCCAAGGATGCGTGGATGGAGAG
GGAGGCCGCCCTATTGAGCCAATTGGAGGAGCTGAGCAGCGGGAAGCGGCACGCGGAGGA
GAAGGCGCTGCAGCTGGGGTGCTCCCTTGATGAGATGAAGGGGAAGCTTGCGGATGCCGA
GCGATCGGTCGCGGGGCATGAGGTTGAGAAGAAGCGGCTTCTGGGGAGATTGGAGGAGGA
AATTGGGAACAAAGATGAGGTTATTCGCCGGCTAGAGAGGGAGATTGCGGAGAAGGCTGC
TGATTTTTCCAGGGAGAGAGATGCCCATCAGAGGCTTTTGCAGCTGGTTGAGTTGAAGGA
CAAGAATTTGCTTCTCGAGCAGAATAAACGGAGGGATGCGGAGGAGATGGCACTGCAGCT
GGGGAACTCTCTTGAGGATATGAAGGGGAACTTTGAGCGATTGATCGCGAGGCATGAGGT
TGAGAAGGAGCGAATTCCGGGGAGGTTGGAGGAGGAAATGGGGAAAAAGGATGAGGTTAT
TGGGCGGCTAGAGAGCGAGATTGCGGAGAAGGCTGCTGATGTCTCTAGGGAAAGAGATGC
CCATCAGAGGATGCTGCAGCAGGTTGAGTTGAAGGATAAGGATCTGCTTCTCGAGCAGAA
TAAGCGGAAGGACCTGATCGAGGATTACACTAAGCTGAAGACACTCTACAAGGATTTGAA
GTCTCAGTACAACTTTCTTGTTGGAAAGATTGGCCAGAATGAAGGCTCCAAGTCTCCTGT
AGTCAATGTGGTGGATCGGAAAACCTCCGGAAGCCCTCCAAGCAAGAGAAAGCTCAAAGA
TCTGGTGGACACTAAAAAGGAGAACAATCAGGCAGTATCTAAGACTGTAGATGAGAAAAA
TGGTCCTGCTTCAAGTGCAAAGGCACAAGGTACCCACCATGCTAGCTCAGTCAGGAGTCC
ATTCAGTAACTCGCGCCTTTGTCTACCGTCTCGTACAACCAATCCTCCACCAAAGAATGC
TACTAGCAATTCAAAAACAGAGGCAGCATCTAGTTTCACCCGCCCAAGTCTACACTGGAG
GGAGACTCGCGCGCGTAAAGAACCAGGCGTTGTAGATCCACATGATGATTTCCTTGACAC
ACCTCTGGAGGCTGTCAAAAATATGATCAGGAATCCTAAAACGCCAGAAGAAGCACAAGC
CCTTGCTGCCTCTCCTCCTAAAGATATGGACTTCAATAACTCTGATGATGAGACTCAAGA
TGTCAATATTGCCACCCAGGGCCAGAAAAACATGCCAGTTCCCAAGCAGCAAAGTACAAT
TTCAATCCAACCACCAAATAAAGGTTTCAAATACACAGAACCTGTAAGAAAAAAGGCTGA
CCGGGAGAATCTGAAAGGCGTTGAGTGCAAGCAGTGCAAGAAATTCTATGATGCTGTTCT
TCCAGATGGCCGCACAAATGGTGACGGTGTGGACTCTACAAGCATGAGGTGTGAGCATCA
TGATGGCGTATCCAGACATCGCTACAGGTACGCGCCGCCGCTGACACCTGAAGGGTTTTG
GAACATTGGGTTTGAATCAGAAATGTAGCACATGAAGTATGATGCGCTCTTCATTGATTA
GTGCAGTGTCGTGCCCTAACATAGGTTCTCAGTCACCCCCCAGATACTGTTAATAATGTC
AGTAGTAAATCTCATGCTGGGGAAATGATCATTTCTTTTTTTAAGATTATATGTTTGGAT
AGAATGCCAATTTGTTGAAGATAGAATGTACTTACTGTCACATCGATTCTATGTAAATGA
CATCTGACATTGAAAAGCAGTCGAATAATCTTGAATAACAAGCGTTATAACGTTACTTG

CDS

1722 bp

>Os06t0613400-01 COM1/SAE2 homolog, Homologous chromosome synapsis and recombination in meiosis
ATGAATGCGAATGTGTTGGGCGGCGATGTGGTGGCGGACGATTTCAACTACTTCTCCGGT
GTGAGCACCATCTTTGTGGCCAACATCCAGGAGGTGAAGGACCGGGTTTCCCAGATCGAG
CTCCTCTTCTGCAGCCAGCTCTTCCCTCATGTCCAGGCCATGTGGAAGGCGGCCAAGGAT
GCGTGGATGGAGAGGGAGGCCGCCCTATTGAGCCAATTGGAGGAGCTGAGCAGCGGGAAG
CGGCACGCGGAGGAGAAGGCGCTGCAGCTGGGGTGCTCCCTTGATGAGATGAAGGGGAAG
CTTGCGGATGCCGAGCGATCGGTCGCGGGGCATGAGGTTGAGAAGAAGCGGCTTCTGGGG
AGATTGGAGGAGGAAATTGGGAACAAAGATGAGGTTATTCGCCGGCTAGAGAGGGAGATT
GCGGAGAAGGCTGCTGATTTTTCCAGGGAGAGAGATGCCCATCAGAGGCTTTTGCAGCTG
GTTGAGTTGAAGGACAAGAATTTGCTTCTCGAGCAGAATAAACGGAGGGATGCGGAGGAG
ATGGCACTGCAGCTGGGGAACTCTCTTGAGGATATGAAGGGGAACTTTGAGCGATTGATC
GCGAGGCATGAGGTTGAGAAGGAGCGAATTCCGGGGAGGTTGGAGGAGGAAATGGGGAAA
AAGGATGAGGTTATTGGGCGGCTAGAGAGCGAGATTGCGGAGAAGGCTGCTGATGTCTCT
AGGGAAAGAGATGCCCATCAGAGGATGCTGCAGCAGGTTGAGTTGAAGGATAAGGATCTG
CTTCTCGAGCAGAATAAGCGGAAGGACCTGATCGAGGATTACACTAAGCTGAAGACACTC
TACAAGGATTTGAAGTCTCAGTACAACTTTCTTGTTGGAAAGATTGGCCAGAATGAAGGC
TCCAAGTCTCCTGTAGTCAATGTGGTGGATCGGAAAACCTCCGGAAGCCCTCCAAGCAAG
AGAAAGCTCAAAGATCTGGTGGACACTAAAAAGGAGAACAATCAGGCAGTATCTAAGACT
GTAGATGAGAAAAATGGTCCTGCTTCAAGTGCAAAGGCACAAGGTACCCACCATGCTAGC
TCAGTCAGGAGTCCATTCAGTAACTCGCGCCTTTGTCTACCGTCTCGTACAACCAATCCT
CCACCAAAGAATGCTACTAGCAATTCAAAAACAGAGGCAGCATCTAGTTTCACCCGCCCA
AGTCTACACTGGAGGGAGACTCGCGCGCGTAAAGAACCAGGCGTTGTAGATCCACATGAT
GATTTCCTTGACACACCTCTGGAGGCTGTCAAAAATATGATCAGGAATCCTAAAACGCCA
GAAGAAGCACAAGCCCTTGCTGCCTCTCCTCCTAAAGATATGGACTTCAATAACTCTGAT
GATGAGACTCAAGATGTCAATATTGCCACCCAGGGCCAGAAAAACATGCCAGTTCCCAAG
CAGCAAAGTACAATTTCAATCCAACCACCAAATAAAGGTTTCAAATACACAGAACCTGTA
AGAAAAAAGGCTGACCGGGAGAATCTGAAAGGCGTTGAGTGCAAGCAGTGCAAGAAATTC
TATGATGCTGTTCTTCCAGATGGCCGCACAAATGGTGACGGTGTGGACTCTACAAGCATG
AGGTGTGAGCATCATGATGGCGTATCCAGACATCGCTACAGGTACGCGCCGCCGCTGACA
CCTGAAGGGTTTTGGAACATTGGGTTTGAATCAGAAATGTAG

Protein

574 aa

>Os06t0613400-01 COM1/SAE2 homolog, Homologous chromosome synapsis and recombination in meiosis
MNANVLGGDVVADDFNYFSGVSTIFVANIQEVKDRVSQIELLFCSQLFPHVQAMWKAAKD
AWMEREAALLSQLEELSSGKRHAEEKALQLGCSLDEMKGKLADAERSVAGHEVEKKRLLG
RLEEEIGNKDEVIRRLEREIAEKAADFSRERDAHQRLLQLVELKDKNLLLEQNKRRDAEE
MALQLGNSLEDMKGNFERLIARHEVEKERIPGRLEEEMGKKDEVIGRLESEIAEKAADVS
RERDAHQRMLQQVELKDKDLLLEQNKRKDLIEDYTKLKTLYKDLKSQYNFLVGKIGQNEG
SKSPVVNVVDRKTSGSPPSKRKLKDLVDTKKENNQAVSKTVDEKNGPASSAKAQGTHHAS
SVRSPFSNSRLCLPSRTTNPPPKNATSNSKTEAASSFTRPSLHWRETRARKEPGVVDPHD
DFLDTPLEAVKNMIRNPKTPEEAQALAASPPKDMDFNNSDDETQDVNIATQGQKNMPVPK
QQSTISIQPPNKGFKYTEPVRKKADRENLKGVECKQCKKFYDAVLPDGRTNGDGVDSTSM
RCEHHDGVSRHRYRYAPPLTPEGFWNIGFESEM*

5'UTR

chr06:24516542..24516765 (+ strand) : 224 bp

chr06:24516952..24516953 (+ strand) : 2 bp

CDS

chr06:24516954..24517926 (+ strand) : 973 bp

chr06:24518237..24518985 (+ strand) : 749 bp

3'UTR

chr06:24518986..24519256 (+ strand) : 271 bp

FASTA

>Os06t0613400-01 class=Sequence position=chr06:24516542..24519256 (+ strand)
GAAAAGCTTT CTCCCCCATT TCAAGCGGCG CGAACGGCGG CGGCGGCCGG CGAGGAGGGC GACGGCTAGG GTTTTTCTCT
CTCTCCGCCG CCGAAATCGA ATCCCCGAGG TGAGCTCCAT CTCATACCCA CCGAGTCTCA CCGTCCCGAC CCATCTCCTT
CACCCGCCGC CGCCGCCTGC GCTGCCCCGC CGATCACCGT GAGCTGCTGC AGCTTCCGCC TCCGGTGAGC ACCCGTTGCC
GACGGACATC GTCTTCCTTC CTCATCCATC TCGTTCTACC CGCTCCATTC CTCGAATTCG CATTAGCCTT CATCTTCTCT
TCTGGATCTG GAAGCTTTTC TGTTCGTCTT AACCCTAGTA CTAATTACAG TTTTTTTTAC CCAAAATTTT TTTTGGTGCC
CTGGCTGTAG AGATGAATGC GAATGTGTTG GGCGGCGATG TGGTGGCGGA CGATTTCAAC TACTTCTCCG GTGTGAGCAC
CATCTTTGTG GCCAACATCC AGGAGGTGAA GGACCGGGTT TCCCAGATCG AGCTCCTCTT CTGCAGCCAG CTCTTCCCTC
ATGTCCAGGC CATGTGGAAG GCGGCCAAGG ATGCGTGGAT GGAGAGGGAG GCCGCCCTAT TGAGCCAATT GGAGGAGCTG
AGCAGCGGGA AGCGGCACGC GGAGGAGAAG GCGCTGCAGC TGGGGTGCTC CCTTGATGAG ATGAAGGGGA AGCTTGCGGA
TGCCGAGCGA TCGGTCGCGG GGCATGAGGT TGAGAAGAAG CGGCTTCTGG GGAGATTGGA GGAGGAAATT GGGAACAAAG
ATGAGGTTAT TCGCCGGCTA GAGAGGGAGA TTGCGGAGAA GGCTGCTGAT TTTTCCAGGG AGAGAGATGC CCATCAGAGG
CTTTTGCAGC TGGTTGAGTT GAAGGACAAG AATTTGCTTC TCGAGCAGAA TAAACGGAGG GATGCGGAGG AGATGGCACT
GCAGCTGGGG AACTCTCTTG AGGATATGAA GGGGAACTTT GAGCGATTGA TCGCGAGGCA TGAGGTTGAG AAGGAGCGAA
TTCCGGGGAG GTTGGAGGAG GAAATGGGGA AAAAGGATGA GGTTATTGGG CGGCTAGAGA GCGAGATTGC GGAGAAGGCT
GCTGATGTCT CTAGGGAAAG AGATGCCCAT CAGAGGATGC TGCAGCAGGT TGAGTTGAAG GATAAGGATC TGCTTCTCGA
GCAGAATAAG CGGAAGGACC TGATCGAGGA TTACACTAAG CTGAAGACAC TCTACAAGGA TTTGAAGTCT CAGTACAACT
TTCTTGTTGG AAAGATTGGC CAGAATGAAG GCTCCAAGTC TCCTGTAGTC AATGTGGTGG ATCGGAAAAC CTCCGGAAGC
CCTCCAAGCA AGAGAAAGCT CAAAGGTACT CCTGCCCTTT GATTTCCTTT CATTCAGTAG AGCTATTTAA ACCTTGTTAA
TCAATCACCA TTTTTATTCT CTAATTACTG TTACCTGGAA GTTTCATTTG AAGAATACCA AGTTTTAATT GCAATTGTGT
ACTATAATCC ATGGTGCTCT GATCAATGCC GCGGTTGAAA GTATTATTAA GCACCTTTGT AATCTGCAAG TAATGTCCTG
CCAATGCTAT CATATTAGCA CTAAGATCTA TGCCTCCTAA ATCGATACTG ATTGATGTCT GCCTTAGCAT TTTCTTTTAC
TTGCTTGATT TTCAGATCTG GTGGACACTA AAAAGGAGAA CAATCAGGCA GTATCTAAGA CTGTAGATGA GAAAAATGGT
CCTGCTTCAA GTGCAAAGGC ACAAGGTACC CACCATGCTA GCTCAGTCAG GAGTCCATTC AGTAACTCGC GCCTTTGTCT
ACCGTCTCGT ACAACCAATC CTCCACCAAA GAATGCTACT AGCAATTCAA AAACAGAGGC AGCATCTAGT TTCACCCGCC
CAAGTCTACA CTGGAGGGAG ACTCGCGCGC GTAAAGAACC AGGCGTTGTA GATCCACATG ATGATTTCCT TGACACACCT
CTGGAGGCTG TCAAAAATAT GATCAGGAAT CCTAAAACGC CAGAAGAAGC ACAAGCCCTT GCTGCCTCTC CTCCTAAAGA
TATGGACTTC AATAACTCTG ATGATGAGAC TCAAGATGTC AATATTGCCA CCCAGGGCCA GAAAAACATG CCAGTTCCCA
AGCAGCAAAG TACAATTTCA ATCCAACCAC CAAATAAAGG TTTCAAATAC ACAGAACCTG TAAGAAAAAA GGCTGACCGG
GAGAATCTGA AAGGCGTTGA GTGCAAGCAG TGCAAGAAAT TCTATGATGC TGTTCTTCCA GATGGCCGCA CAAATGGTGA
CGGTGTGGAC TCTACAAGCA TGAGGTGTGA GCATCATGAT GGCGTATCCA GACATCGCTA CAGGTACGCG CCGCCGCTGA
CACCTGAAGG GTTTTGGAAC ATTGGGTTTG AATCAGAAAT GTAGCACATG AAGTATGATG CGCTCTTCAT TGATTAGTGC
AGTGTCGTGC CCTAACATAG GTTCTCAGTC ACCCCCCAGA TACTGTTAAT AATGTCAGTA GTAAATCTCA TGCTGGGGAA
ATGATCATTT CTTTTTTTAA GATTATATGT TTGGATAGAA TGCCAATTTG TTGAAGATAG AATGTACTTA CTGTCACATC
GATTCTATGT AAATGACATC TGACATTGAA AAGCAGTCGA ATAATCTTGA ATAACAAGCG TTATAACGTT ACTTG

Locus: Os06g0613400

Loading...

Locus: Os06g0613400

Loading...