Os06t0623700-01

Locus

Os06g0623700

Description

Protein with indole-3-acetic acid (IAA)-glucose hydrolase activity, Regulation of grain length and weight

RAP-DB Gene Symbol Synonym(s)

TGW6, tgw6

RAP-DB Gene Name Synonym(s)

TOTAL GRAIN WEIGHT6, total grain weight6, THOUSAND-GRAIN WEIGHT 6

CGSNL Gene Symbol

TGW6

CGSNL Gene Name

TOTAL GRAIN WEIGHT6

Oryzabase Gene Symbol Synonym(s)

tgw6, OsSTRL7, STRL7

Oryzabase Gene Name Synonym(s)

total grain weight6, THOUSAND-GRAIN WEIGHT 6, STR-like 7

Transcript Evidence

AB513135

Protein Evidence

Q69U01

Literature

PMID: 23583977

Note

Manual Curation

July 6, 2016

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: strictosidine synthase activity (GO:0016844)

Functional domain (InterPro)

Strictosidine synthase (IPR004141)

Six-bladed beta-propeller, TolB-like (IPR011042)

Strictosidine synthase, conserved region (IPR018119)

Expression Databases

TENOR (Os06t0623700-00)

Others

Oryzabase (6464)

Transcript

1053 bp

>Os06t0623700-01 Protein with indole-3-acetic acid (IAA)-glucose hydrolase activity, Regulation of grain length and weight
ATGAGAAgcacggcgaggcaagcggcgaccgcggcggcgttcgcgctcattgtcttcctc
gtgctgctctcgccgtcccctactgccgccgccacagccacaacgagaatgttcaagacc
attgacgcccggcggagccagcatctggacctcggcggatcactggtcggcccggagagc
gtcgcgttcgacggcaaaggccgcggcccgtacagcggcgtctccgacggccgcatcatg
aggtggaacggcgaggccgctggctggaGCACCTACACGTACAGCCCCAGCTACACGAAA
AACAAGTGCGCGGCATCGACTCTCCCCACGGTCCAGACCGAGAGCAAATGCGGCCGCCCG
TTAGGCCTACGGTTTCACTACAAAACCGGCAACCTGTACATCGCCGACGCCTACATGGGA
TTGATGCGAGTTGGTCCAAAAGGCGGGGAGGCAACCGTGCTAGCCATGAAGGCTGATGGC
GTGCCACTTCGCTTCACCAATGGGGTGGACATTGATCAGGTTACCGGAGATGTTTATTTC
ACCGACAGCAGCATGAACTACCAACGATCTCAGCACGAGCAAGTCACGGCGACCAAGGAT
TCGACCGGACGGCTCATGAAGTATGACCCACGAACTAACCAAgtcaccgttcttcaatcc
aacataacctacccgaacggtgtcgccatgagcgctgaccgaacacatctgatcgttgca
ttgaccgggccatgtaagttgatgaggcattggatccgaggcccgaagactggcaaatct
gaaccatttgttgacctgccaggctatcctgataatgtgaggcctgatggaaaaggtggt
tattggatagcgctTCATCGCGAGAAGTATGAGCTTCCCTTTGGTCCGGATAGTCACTTG
GTTGCTATGAGGGTTAGTGCTGGTGGGAAGCTGGTTCAACAGATGAGAGGACCAAAGAGC
TTGAGGCCAACCGAAGTGATGGAGAGGAAGGATGGCAAAATATACATGGGAAATGTTGAA
TTGCCGTATGTCGGAGTCGTCAAAAGCAGCTAG

CDS

1053 bp

>Os06t0623700-01 Protein with indole-3-acetic acid (IAA)-glucose hydrolase activity, Regulation of grain length and weight
ATGAGAAgcacggcgaggcaagcggcgaccgcggcggcgttcgcgctcattgtcttcctc
gtgctgctctcgccgtcccctactgccgccgccacagccacaacgagaatgttcaagacc
attgacgcccggcggagccagcatctggacctcggcggatcactggtcggcccggagagc
gtcgcgttcgacggcaaaggccgcggcccgtacagcggcgtctccgacggccgcatcatg
aggtggaacggcgaggccgctggctggaGCACCTACACGTACAGCCCCAGCTACACGAAA
AACAAGTGCGCGGCATCGACTCTCCCCACGGTCCAGACCGAGAGCAAATGCGGCCGCCCG
TTAGGCCTACGGTTTCACTACAAAACCGGCAACCTGTACATCGCCGACGCCTACATGGGA
TTGATGCGAGTTGGTCCAAAAGGCGGGGAGGCAACCGTGCTAGCCATGAAGGCTGATGGC
GTGCCACTTCGCTTCACCAATGGGGTGGACATTGATCAGGTTACCGGAGATGTTTATTTC
ACCGACAGCAGCATGAACTACCAACGATCTCAGCACGAGCAAGTCACGGCGACCAAGGAT
TCGACCGGACGGCTCATGAAGTATGACCCACGAACTAACCAAgtcaccgttcttcaatcc
aacataacctacccgaacggtgtcgccatgagcgctgaccgaacacatctgatcgttgca
ttgaccgggccatgtaagttgatgaggcattggatccgaggcccgaagactggcaaatct
gaaccatttgttgacctgccaggctatcctgataatgtgaggcctgatggaaaaggtggt
tattggatagcgctTCATCGCGAGAAGTATGAGCTTCCCTTTGGTCCGGATAGTCACTTG
GTTGCTATGAGGGTTAGTGCTGGTGGGAAGCTGGTTCAACAGATGAGAGGACCAAAGAGC
TTGAGGCCAACCGAAGTGATGGAGAGGAAGGATGGCAAAATATACATGGGAAATGTTGAA
TTGCCGTATGTCGGAGTCGTCAAAAGCAGCTAG

Protein

351 aa

>Os06t0623700-01 Protein with indole-3-acetic acid (IAA)-glucose hydrolase activity, Regulation of grain length and weight
MRSTARQAATAAAFALIVFLVLLSPSPTAAATATTRMFKTIDARRSQHLDLGGSLVGPES
VAFDGKGRGPYSGVSDGRIMRWNGEAAGWSTYTYSPSYTKNKCAASTLPTVQTESKCGRP
LGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLAMKADGVPLRFTNGVDIDQVTGDVYF
TDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAMSADRTHLIVA
LTGPCKLMRHWIRGPKTGKSEPFVDLPGYPDNVRPDGKGGYWIALHREKYELPFGPDSHL
VAMRVSAGGKLVQQMRGPKSLRPTEVMERKDGKIYMGNVELPYVGVVKSS*

CDS

chr06:25093242..25094294 (+ strand) : 1053 bp

FASTA

>Os06t0623700-01 class=Sequence position=chr06:25093242..25094294 (+ strand)
ATGAGAAgca cggcgaggca agcggcgacc gcggcggcgt tcgcgctcat tgtcttcctc gtgctgctct cgccgtcccc
tactgccgcc gccacagcca caacgagaat gttcaagacc attgacgccc ggcggagcca gcatctggac ctcggcggat
cactggtcgg cccggagagc gtcgcgttcg acggcaaagg ccgcggcccg tacagcggcg tctccgacgg ccgcatcatg
aggtggaacg gcgaggccgc tggctggaGC ACCTACACGT ACAGCCCCAG CTACACGAAA AACAAGTGCG CGGCATCGAC
TCTCCCCACG GTCCAGACCG AGAGCAAATG CGGCCGCCCG TTAGGCCTAC GGTTTCACTA CAAAACCGGC AACCTGTACA
TCGCCGACGC CTACATGGGA TTGATGCGAG TTGGTCCAAA AGGCGGGGAG GCAACCGTGC TAGCCATGAA GGCTGATGGC
GTGCCACTTC GCTTCACCAA TGGGGTGGAC ATTGATCAGG TTACCGGAGA TGTTTATTTC ACCGACAGCA GCATGAACTA
CCAACGATCT CAGCACGAGC AAGTCACGGC GACCAAGGAT TCGACCGGAC GGCTCATGAA GTATGACCCA CGAACTAACC
AAgtcaccgt tcttcaatcc aacataacct acccgaacgg tgtcgccatg agcgctgacc gaacacatct gatcgttgca
ttgaccgggc catgtaagtt gatgaggcat tggatccgag gcccgaagac tggcaaatct gaaccatttg ttgacctgcc
aggctatcct gataatgtga ggcctgatgg aaaaggtggt tattggatag cgctTCATCG CGAGAAGTAT GAGCTTCCCT
TTGGTCCGGA TAGTCACTTG GTTGCTATGA GGGTTAGTGC TGGTGGGAAG CTGGTTCAAC AGATGAGAGG ACCAAAGAGC
TTGAGGCCAA CCGAAGTGAT GGAGAGGAAG GATGGCAAAA TATACATGGG AAATGTTGAA TTGCCGTATG TCGGAGTCGT
CAAAAGCAGC TAG