Os06t0625200-00

Locus

Os06g0625200

Description

Protein kinase-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK6, OsLYK3

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 6, LysM-type receptor-like kinase3

Transcript Evidence

AK370300 (DDBJ)

Protein Evidence

NP_001147941.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Expression Databases

TENOR (Os06t0625200-00)

Others

Oryzabase (10925)

Transcript

1939 bp

>Os06t0625200-00 Protein kinase-like domain containing protein.
AGCCATGCCGCCCGGCGCGCGAGCAAGACGCATCGCCGCACTCGACCTGATCTTCCTCGT
GTTTCTCCGGCTCGCCAGCGCGTATCAACGACCATCCGACGCGCATATCAACTGCATCGA
CAGCTTCTGTCTCGGCGGCTACACCTGCAGCGAAACcaccgccaccacgtcctgcaccgc
ctacctcaccttccgctccgaccccccgctctccgtcgcctacctcctcaacgcgacgcc
ctccgccgtcgccgccgccaactctgtccccctcgccgtctcccccgtcgACGGCACGCA
GCTCCTCCTCGTCCCTGTCCCCTGCTCCTGCAACCGGGCCACCGGCTACTACCAACACAA
CACCACCTACGCCATTCAGGAACTTGATACCTTCTTCCTCATCGCCAATAACACGTTCCA
GGGGCTCACGACGTACCAAAGCATCATCGCCAATAACCCTGCAAGCGAAGCTATGTCTCC
AGTGATCAACGGCCCCCTCGCCGTGCCGCTCCGCTGCGCGTGCCCCTCTGCGACTACGGG
ACGAATAAACAATCTGCTGACGTACGTGGTCCAGGAGGGGGACAACGTGACCAGCATCGC
GCGCAGATTCAACTCTACGCACGGCGACGTGCTTGCCGCCAACACGTTGTTGGTCCCGCT
CGTCCACCCGCCGCATTCGCGAGTGGTGCTCGCGAATACTACTATTACTTCCACGACTCC
GCCGGAATCTCAGAAATTTTACGTGTCGAGTCCCTGCAGCAATGGCTTGCTGGCTGGCTT
GGGTATCGGCGTCGGATGCGGCGTCTCTGCGTGGGCTGCCGTTCTTGCTGTGTTCTTGCT
ATGGCGTCGAAGGCGGCGGCGCCCCGTCGGCGACAGCTCAGGCATGGCCAGGGAGACCCC
CCTGGTAGCGGCTGTGCGTGGCGCGGTGGAGACTCTGGCTGCCTACAGCTACGCGGACAT
CGAGACGGCGACGGCGGGGTTCGCGGAGGAGCGGAGAGTGGCCGCCGGATCGTCGGTGTA
CCGCGCGGTGATCAACGGCGAGGCTTTCGCGGTGAAACGCGTGGCCGCCGGCGGCGACGA
CGTGCGCGGTGAGGTCGACGTCCTCGGCCGCGTCAACCACTCCGGCCTCGTCCGGCTCCG
GGGCCTGTGCGCGAACGGAGACGACACCTACCTGGTGCTCGAGTTCGCCGAGAACGGCGC
GCTCAGCGAGTGGCTTCACCCCGGCAGCGCAGCCGCGTGTCTCCGCCGTGTCCTCGGCTG
GAAGCAGCGCGTTCTGGTGGCGCTCGACGTCGCGGGTGGGCTCAACTACCTGCACCACTT
CACCAACCCTCCCTACGTGCACAAGAATCTCAACAGCGGCAACGTCCTCCTCGACGCGAA
CCTCCGCGCGAAGGTCTCGAGCCTCGGGTTCGCGCGCGCCGTGGCCGTCGCCGTCGCAGC
CGGAGACGACAGCATCGCCCTGATGACACACCACGTCGTGGGCACCCACGGTTACCTGGC
GCCGGAGTACCTGGAGCACGGCCTGATCAGTCCCAAGCTCGACGTGTTCAGCTTCGGTGT
CATCCAGCTCGAGCTCTTGTCCGGGAAGACGGCGGCGTTTGTCACCGACGATGACGGGCA
GAACATGCTGCTGTGGCAGGCGGCGGACGGGCTCGTCGACGGCGATGGCGCATGGTTCAA
GCTGAGGGCGTTCATGGACCCTCAGCTGCAAGGCCACTACCCGATCGGTGTCGCGTCCGC
GGTGGCCGCGCTGGCCGTTCGGTGCGTGGCGCGGGAGCCACGGGCGCGGCCTTCCATGGA
GGAGGTGTTCGTCACGCTCTCAGCGGTGTACAACCTCACGGTTGATTGGGATCCTCAGAA
TTACAGCGCATCAGCTTCTATGGTCCTCGGTAGGTAGCAATTAAGGAAGCTCAATTTTTT
CGACGTGAGATATTAAGAA

CDS

1893 bp

>Os06t0625200-00 Protein kinase-like domain containing protein.
ATGCCGCCCGGCGCGCGAGCAAGACGCATCGCCGCACTCGACCTGATCTTCCTCGTGTTT
CTCCGGCTCGCCAGCGCGTATCAACGACCATCCGACGCGCATATCAACTGCATCGACAGC
TTCTGTCTCGGCGGCTACACCTGCAGCGAAACcaccgccaccacgtcctgcaccgcctac
ctcaccttccgctccgaccccccgctctccgtcgcctacctcctcaacgcgacgccctcc
gccgtcgccgccgccaactctgtccccctcgccgtctcccccgtcgACGGCACGCAGCTC
CTCCTCGTCCCTGTCCCCTGCTCCTGCAACCGGGCCACCGGCTACTACCAACACAACACC
ACCTACGCCATTCAGGAACTTGATACCTTCTTCCTCATCGCCAATAACACGTTCCAGGGG
CTCACGACGTACCAAAGCATCATCGCCAATAACCCTGCAAGCGAAGCTATGTCTCCAGTG
ATCAACGGCCCCCTCGCCGTGCCGCTCCGCTGCGCGTGCCCCTCTGCGACTACGGGACGA
ATAAACAATCTGCTGACGTACGTGGTCCAGGAGGGGGACAACGTGACCAGCATCGCGCGC
AGATTCAACTCTACGCACGGCGACGTGCTTGCCGCCAACACGTTGTTGGTCCCGCTCGTC
CACCCGCCGCATTCGCGAGTGGTGCTCGCGAATACTACTATTACTTCCACGACTCCGCCG
GAATCTCAGAAATTTTACGTGTCGAGTCCCTGCAGCAATGGCTTGCTGGCTGGCTTGGGT
ATCGGCGTCGGATGCGGCGTCTCTGCGTGGGCTGCCGTTCTTGCTGTGTTCTTGCTATGG
CGTCGAAGGCGGCGGCGCCCCGTCGGCGACAGCTCAGGCATGGCCAGGGAGACCCCCCTG
GTAGCGGCTGTGCGTGGCGCGGTGGAGACTCTGGCTGCCTACAGCTACGCGGACATCGAG
ACGGCGACGGCGGGGTTCGCGGAGGAGCGGAGAGTGGCCGCCGGATCGTCGGTGTACCGC
GCGGTGATCAACGGCGAGGCTTTCGCGGTGAAACGCGTGGCCGCCGGCGGCGACGACGTG
CGCGGTGAGGTCGACGTCCTCGGCCGCGTCAACCACTCCGGCCTCGTCCGGCTCCGGGGC
CTGTGCGCGAACGGAGACGACACCTACCTGGTGCTCGAGTTCGCCGAGAACGGCGCGCTC
AGCGAGTGGCTTCACCCCGGCAGCGCAGCCGCGTGTCTCCGCCGTGTCCTCGGCTGGAAG
CAGCGCGTTCTGGTGGCGCTCGACGTCGCGGGTGGGCTCAACTACCTGCACCACTTCACC
AACCCTCCCTACGTGCACAAGAATCTCAACAGCGGCAACGTCCTCCTCGACGCGAACCTC
CGCGCGAAGGTCTCGAGCCTCGGGTTCGCGCGCGCCGTGGCCGTCGCCGTCGCAGCCGGA
GACGACAGCATCGCCCTGATGACACACCACGTCGTGGGCACCCACGGTTACCTGGCGCCG
GAGTACCTGGAGCACGGCCTGATCAGTCCCAAGCTCGACGTGTTCAGCTTCGGTGTCATC
CAGCTCGAGCTCTTGTCCGGGAAGACGGCGGCGTTTGTCACCGACGATGACGGGCAGAAC
ATGCTGCTGTGGCAGGCGGCGGACGGGCTCGTCGACGGCGATGGCGCATGGTTCAAGCTG
AGGGCGTTCATGGACCCTCAGCTGCAAGGCCACTACCCGATCGGTGTCGCGTCCGCGGTG
GCCGCGCTGGCCGTTCGGTGCGTGGCGCGGGAGCCACGGGCGCGGCCTTCCATGGAGGAG
GTGTTCGTCACGCTCTCAGCGGTGTACAACCTCACGGTTGATTGGGATCCTCAGAATTAC
AGCGCATCAGCTTCTATGGTCCTCGGTAGGTAG

Protein

631 aa

>Os06t0625200-00 Protein kinase-like domain containing protein.
MPPGARARRIAALDLIFLVFLRLASAYQRPSDAHINCIDSFCLGGYTCSETTATTSCTAY
LTFRSDPPLSVAYLLNATPSAVAAANSVPLAVSPVDGTQLLLVPVPCSCNRATGYYQHNT
TYAIQELDTFFLIANNTFQGLTTYQSIIANNPASEAMSPVINGPLAVPLRCACPSATTGR
INNLLTYVVQEGDNVTSIARRFNSTHGDVLAANTLLVPLVHPPHSRVVLANTTITSTTPP
ESQKFYVSSPCSNGLLAGLGIGVGCGVSAWAAVLAVFLLWRRRRRRPVGDSSGMARETPL
VAAVRGAVETLAAYSYADIETATAGFAEERRVAAGSSVYRAVINGEAFAVKRVAAGGDDV
RGEVDVLGRVNHSGLVRLRGLCANGDDTYLVLEFAENGALSEWLHPGSAAACLRRVLGWK
QRVLVALDVAGGLNYLHHFTNPPYVHKNLNSGNVLLDANLRAKVSSLGFARAVAVAVAAG
DDSIALMTHHVVGTHGYLAPEYLEHGLISPKLDVFSFGVIQLELLSGKTAAFVTDDDGQN
MLLWQAADGLVDGDGAWFKLRAFMDPQLQGHYPIGVASAVAALAVRCVAREPRARPSMEE
VFVTLSAVYNLTVDWDPQNYSASASMVLGR*

5'UTR

chr06:25184928..25184931 (- strand) : 4 bp

CDS

chr06:25183035..25184927 (- strand) : 1893 bp

3'UTR

chr06:25182993..25183034 (- strand) : 42 bp

FASTA

>Os06t0625200-00 class=Sequence position=chr06:25182993..25184931 (- strand)
AGCCATGCCG CCCGGCGCGC GAGCAAGACG CATCGCCGCA CTCGACCTGA TCTTCCTCGT GTTTCTCCGG CTCGCCAGCG
CGTATCAACG ACCATCCGAC GCGCATATCA ACTGCATCGA CAGCTTCTGT CTCGGCGGCT ACACCTGCAG CGAAACcacc
gccaccacgt cctgcaccgc ctacctcacc ttccgctccg accccccgct ctccgtcgcc tacctcctca acgcgacgcc
ctccgccgtc gccgccgcca actctgtccc cctcgccgtc tcccccgtcg ACGGCACGCA GCTCCTCCTC GTCCCTGTCC
CCTGCTCCTG CAACCGGGCC ACCGGCTACT ACCAACACAA CACCACCTAC GCCATTCAGG AACTTGATAC CTTCTTCCTC
ATCGCCAATA ACACGTTCCA GGGGCTCACG ACGTACCAAA GCATCATCGC CAATAACCCT GCAAGCGAAG CTATGTCTCC
AGTGATCAAC GGCCCCCTCG CCGTGCCGCT CCGCTGCGCG TGCCCCTCTG CGACTACGGG ACGAATAAAC AATCTGCTGA
CGTACGTGGT CCAGGAGGGG GACAACGTGA CCAGCATCGC GCGCAGATTC AACTCTACGC ACGGCGACGT GCTTGCCGCC
AACACGTTGT TGGTCCCGCT CGTCCACCCG CCGCATTCGC GAGTGGTGCT CGCGAATACT ACTATTACTT CCACGACTCC
GCCGGAATCT CAGAAATTTT ACGTGTCGAG TCCCTGCAGC AATGGCTTGC TGGCTGGCTT GGGTATCGGC GTCGGATGCG
GCGTCTCTGC GTGGGCTGCC GTTCTTGCTG TGTTCTTGCT ATGGCGTCGA AGGCGGCGGC GCCCCGTCGG CGACAGCTCA
GGCATGGCCA GGGAGACCCC CCTGGTAGCG GCTGTGCGTG GCGCGGTGGA GACTCTGGCT GCCTACAGCT ACGCGGACAT
CGAGACGGCG ACGGCGGGGT TCGCGGAGGA GCGGAGAGTG GCCGCCGGAT CGTCGGTGTA CCGCGCGGTG ATCAACGGCG
AGGCTTTCGC GGTGAAACGC GTGGCCGCCG GCGGCGACGA CGTGCGCGGT GAGGTCGACG TCCTCGGCCG CGTCAACCAC
TCCGGCCTCG TCCGGCTCCG GGGCCTGTGC GCGAACGGAG ACGACACCTA CCTGGTGCTC GAGTTCGCCG AGAACGGCGC
GCTCAGCGAG TGGCTTCACC CCGGCAGCGC AGCCGCGTGT CTCCGCCGTG TCCTCGGCTG GAAGCAGCGC GTTCTGGTGG
CGCTCGACGT CGCGGGTGGG CTCAACTACC TGCACCACTT CACCAACCCT CCCTACGTGC ACAAGAATCT CAACAGCGGC
AACGTCCTCC TCGACGCGAA CCTCCGCGCG AAGGTCTCGA GCCTCGGGTT CGCGCGCGCC GTGGCCGTCG CCGTCGCAGC
CGGAGACGAC AGCATCGCCC TGATGACACA CCACGTCGTG GGCACCCACG GTTACCTGGC GCCGGAGTAC CTGGAGCACG
GCCTGATCAG TCCCAAGCTC GACGTGTTCA GCTTCGGTGT CATCCAGCTC GAGCTCTTGT CCGGGAAGAC GGCGGCGTTT
GTCACCGACG ATGACGGGCA GAACATGCTG CTGTGGCAGG CGGCGGACGG GCTCGTCGAC GGCGATGGCG CATGGTTCAA
GCTGAGGGCG TTCATGGACC CTCAGCTGCA AGGCCACTAC CCGATCGGTG TCGCGTCCGC GGTGGCCGCG CTGGCCGTTC
GGTGCGTGGC GCGGGAGCCA CGGGCGCGGC CTTCCATGGA GGAGGTGTTC GTCACGCTCT CAGCGGTGTA CAACCTCACG
GTTGATTGGG ATCCTCAGAA TTACAGCGCA TCAGCTTCTA TGGTCCTCGG TAGGTAGCAA TTAAGGAAGC TCAATTTTTT
CGACGTGAGA TATTAAGAA

Locus: Os06g0625200

Loading...

Locus: Os06g0625200

Loading...