Os06t0625300-00

Locus

Os06g0625300

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK5, OsLYK2

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 5, LysM-type receptor-like kinase2

Transcript Evidence

Protein Evidence

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os06t0625300-00)

Others

Oryzabase (10924)

Transcript

1542 bp

>Os06t0625300-00
ATGTCGATGCTGCCGCGCTTCCTCCTCCTCGTCGTGCTGCTCGCGGTGCCGATGACGGCG
GCGCAGCAGCAGTACGAGGCCAACGCGCAGGGCGACTGCTACACCGACAACGGCAGCTCC
GTCCTCGGCTACACCTGCGGCACCGCCGCCTCCCCGCCGCCGCCGCCATGCACGGCCTAC
CTCACCTTCCGCTCCGCCCCACCGAGCTACGCCTCCCCGATCACCGTCTCCTACCTCCTC
AACGCCAGCGTCCCCGCCGTCGCCGCCGCCAACTCCGTCCCGGTCTCGCCTCCGGTCGCC
CGCGACGGCCTCCTCCTCGTCCCCGTCCCCTGCGCCTGCACCGCCGCCGGGTACTACCAG
CACGACGCCGGCTACGTCATCCAGTTCGACGACGAGACCTACTTCGTCATGGCGAACGAC
ACGTACCAGGGGCTCACGACGTGCCAGGCGCTCATGGCGCAGAACCCGGCGCACGACAGC
CTCGACCTCTACCCGGGAATCAGACTCACCGTGCCGCTGCGCTGCGCGTGCCCGTCGCCG
GCGCAGGCCGCCGCCGGCGTGAGGTACCTAGTGACGTACCTCCTCGGCTGGGACGACGAC
TCGTCCACCGTCGCCGACCGCTTCGGCGCCGACTACCAGGCCGTTCTCTTCGCCAACAAC
CTCACCGACGACTCCACGGTGTATCCCTTCACCACGATGCTTGTCCCGCTCAAGCATCGG
CCCAAGCCCGACGTGACGGTCTTGCCGGAGCCGGGGCCTCCTTCTCCGGCTCCGGCTCCG
GCAGTGTCAGCTCCGCCGCCGCCGGCGGTGCCTTCCAGCGAATCGGGCAGTGGGAGGTGG
AAGAAATCCTTTCGCGGTAGGTGTATCGGCATTGGAGTTGGTGTTGGGTTCGCCGTTCTT
GCGTCTGGTGCTCTGCTTGCTCTGTTCTTGCTACGGCGTCGGTGGCGGTGGCGTGGCAAC
GGCGAGCTTCACGATGTGCCGTTGGCTCCGGATAAGGAGGGAGCGAAGGCGACGCCGCCG
CCGTGGATGCTGCCGACGACGGTGGCGGACGTCGACGTGCGCGATGCCGTGGGATCGATG
GCCGTGTACGAGTACGGCGAGCTGGAGCGGGTGACGGCCGGGTTCGCGGAGGAGCGGCGC
ATCGGGGACTCGTCGGTCTACCGCGCGGTGATCAACGGCGACGTCGCGGCGGCGGTGAAG
CGCGTCGCCGGCGACGTGGGCGCCGAGGAGGCAGCGCCTGCGCGAGACGGCGGCGAGGGT
GGCGATGGCGAAGCATTGGCGTTGCTGCTGTGGGAGGAAGCGGAGGGGCAGCTGGTGGTC
GACGGCGACGATGACGACGCGCGGGGCAAGGTGGCGGCGTTCATGGACTCCCGGTTGCGT
GGCGACTACCCGTCGGAGGTGGCTCTCGCGATGGCTGCGCTGGCGCTGCGGTGCGTCGCG
CGGGAGCCCCGCGCGCGGCCGTCGATGGTGGAGGTGTTCCTCTCGCTCTCGGCGTTGCAC
GGCACAACGTTGGATTGGGCCCCCCATGCAACCCTGAGTTGA

CDS

1542 bp

>Os06t0625300-00
ATGTCGATGCTGCCGCGCTTCCTCCTCCTCGTCGTGCTGCTCGCGGTGCCGATGACGGCG
GCGCAGCAGCAGTACGAGGCCAACGCGCAGGGCGACTGCTACACCGACAACGGCAGCTCC
GTCCTCGGCTACACCTGCGGCACCGCCGCCTCCCCGCCGCCGCCGCCATGCACGGCCTAC
CTCACCTTCCGCTCCGCCCCACCGAGCTACGCCTCCCCGATCACCGTCTCCTACCTCCTC
AACGCCAGCGTCCCCGCCGTCGCCGCCGCCAACTCCGTCCCGGTCTCGCCTCCGGTCGCC
CGCGACGGCCTCCTCCTCGTCCCCGTCCCCTGCGCCTGCACCGCCGCCGGGTACTACCAG
CACGACGCCGGCTACGTCATCCAGTTCGACGACGAGACCTACTTCGTCATGGCGAACGAC
ACGTACCAGGGGCTCACGACGTGCCAGGCGCTCATGGCGCAGAACCCGGCGCACGACAGC
CTCGACCTCTACCCGGGAATCAGACTCACCGTGCCGCTGCGCTGCGCGTGCCCGTCGCCG
GCGCAGGCCGCCGCCGGCGTGAGGTACCTAGTGACGTACCTCCTCGGCTGGGACGACGAC
TCGTCCACCGTCGCCGACCGCTTCGGCGCCGACTACCAGGCCGTTCTCTTCGCCAACAAC
CTCACCGACGACTCCACGGTGTATCCCTTCACCACGATGCTTGTCCCGCTCAAGCATCGG
CCCAAGCCCGACGTGACGGTCTTGCCGGAGCCGGGGCCTCCTTCTCCGGCTCCGGCTCCG
GCAGTGTCAGCTCCGCCGCCGCCGGCGGTGCCTTCCAGCGAATCGGGCAGTGGGAGGTGG
AAGAAATCCTTTCGCGGTAGGTGTATCGGCATTGGAGTTGGTGTTGGGTTCGCCGTTCTT
GCGTCTGGTGCTCTGCTTGCTCTGTTCTTGCTACGGCGTCGGTGGCGGTGGCGTGGCAAC
GGCGAGCTTCACGATGTGCCGTTGGCTCCGGATAAGGAGGGAGCGAAGGCGACGCCGCCG
CCGTGGATGCTGCCGACGACGGTGGCGGACGTCGACGTGCGCGATGCCGTGGGATCGATG
GCCGTGTACGAGTACGGCGAGCTGGAGCGGGTGACGGCCGGGTTCGCGGAGGAGCGGCGC
ATCGGGGACTCGTCGGTCTACCGCGCGGTGATCAACGGCGACGTCGCGGCGGCGGTGAAG
CGCGTCGCCGGCGACGTGGGCGCCGAGGAGGCAGCGCCTGCGCGAGACGGCGGCGAGGGT
GGCGATGGCGAAGCATTGGCGTTGCTGCTGTGGGAGGAAGCGGAGGGGCAGCTGGTGGTC
GACGGCGACGATGACGACGCGCGGGGCAAGGTGGCGGCGTTCATGGACTCCCGGTTGCGT
GGCGACTACCCGTCGGAGGTGGCTCTCGCGATGGCTGCGCTGGCGCTGCGGTGCGTCGCG
CGGGAGCCCCGCGCGCGGCCGTCGATGGTGGAGGTGTTCCTCTCGCTCTCGGCGTTGCAC
GGCACAACGTTGGATTGGGCCCCCCATGCAACCCTGAGTTGA

Protein

514 aa

>Os06t0625300-00
MSMLPRFLLLVVLLAVPMTAAQQQYEANAQGDCYTDNGSSVLGYTCGTAASPPPPPCTAY
LTFRSAPPSYASPITVSYLLNASVPAVAAANSVPVSPPVARDGLLLVPVPCACTAAGYYQ
HDAGYVIQFDDETYFVMANDTYQGLTTCQALMAQNPAHDSLDLYPGIRLTVPLRCACPSP
AQAAAGVRYLVTYLLGWDDDSSTVADRFGADYQAVLFANNLTDDSTVYPFTTMLVPLKHR
PKPDVTVLPEPGPPSPAPAPAVSAPPPPAVPSSESGSGRWKKSFRGRCIGIGVGVGFAVL
ASGALLALFLLRRRWRWRGNGELHDVPLAPDKEGAKATPPPWMLPTTVADVDVRDAVGSM
AVYEYGELERVTAGFAEERRIGDSSVYRAVINGDVAAAVKRVAGDVGAEEAAPARDGGEG
GDGEALALLLWEEAEGQLVVDGDDDDARGKVAAFMDSRLRGDYPSEVALAMAALALRCVA
REPRARPSMVEVFLSLSALHGTTLDWAPHATLS*

CDS

chr06:25198242..25199468 (+ strand) : 1227 bp

chr06:25199931..25200245 (+ strand) : 315 bp

FASTA

>Os06t0625300-00 class=Sequence position=chr06:25198242..25200245 (+ strand)
ATGTCGATGC TGCCGCGCTT CCTCCTCCTC GTCGTGCTGC TCGCGGTGCC GATGACGGCG GCGCAGCAGC AGTACGAGGC
CAACGCGCAG GGCGACTGCT ACACCGACAA CGGCAGCTCC GTCCTCGGCT ACACCTGCGG CACCGCCGCC TCCCCGCCGC
CGCCGCCATG CACGGCCTAC CTCACCTTCC GCTCCGCCCC ACCGAGCTAC GCCTCCCCGA TCACCGTCTC CTACCTCCTC
AACGCCAGCG TCCCCGCCGT CGCCGCCGCC AACTCCGTCC CGGTCTCGCC TCCGGTCGCC CGCGACGGCC TCCTCCTCGT
CCCCGTCCCC TGCGCCTGCA CCGCCGCCGG GTACTACCAG CACGACGCCG GCTACGTCAT CCAGTTCGAC GACGAGACCT
ACTTCGTCAT GGCGAACGAC ACGTACCAGG GGCTCACGAC GTGCCAGGCG CTCATGGCGC AGAACCCGGC GCACGACAGC
CTCGACCTCT ACCCGGGAAT CAGACTCACC GTGCCGCTGC GCTGCGCGTG CCCGTCGCCG GCGCAGGCCG CCGCCGGCGT
GAGGTACCTA GTGACGTACC TCCTCGGCTG GGACGACGAC TCGTCCACCG TCGCCGACCG CTTCGGCGCC GACTACCAGG
CCGTTCTCTT CGCCAACAAC CTCACCGACG ACTCCACGGT GTATCCCTTC ACCACGATGC TTGTCCCGCT CAAGCATCGG
CCCAAGCCCG ACGTGACGGT CTTGCCGGAG CCGGGGCCTC CTTCTCCGGC TCCGGCTCCG GCAGTGTCAG CTCCGCCGCC
GCCGGCGGTG CCTTCCAGCG AATCGGGCAG TGGGAGGTGG AAGAAATCCT TTCGCGGTAG GTGTATCGGC ATTGGAGTTG
GTGTTGGGTT CGCCGTTCTT GCGTCTGGTG CTCTGCTTGC TCTGTTCTTG CTACGGCGTC GGTGGCGGTG GCGTGGCAAC
GGCGAGCTTC ACGATGTGCC GTTGGCTCCG GATAAGGAGG GAGCGAAGGC GACGCCGCCG CCGTGGATGC TGCCGACGAC
GGTGGCGGAC GTCGACGTGC GCGATGCCGT GGGATCGATG GCCGTGTACG AGTACGGCGA GCTGGAGCGG GTGACGGCCG
GGTTCGCGGA GGAGCGGCGC ATCGGGGACT CGTCGGTCTA CCGCGCGGTG ATCAACGGCG ACGTCGCGGC GGCGGTGAAG
CGCGTCGCCG GCGACGTGGG CGCCGAGGTG AGCGTCCTGG GACGCGTCAG CCACTCGTGC CTCGTCCGCC TGTTCGGCCT
CTGCGTGCAC CGCGGCGACA CGTACCTGGT GTTCGAGCTC GCCGAGAACG GCGCGCTCAG CGACTGGATC CGCGGCGACA
ACGGCGGCCG CGCCCTCTCG TGGAGGCAGC GGATGCAGGC GGCGCTCGAC GTGGCCGACG GGCTCAACTA CCTCCACAAC
TACACCAGGC CGCCCTAcgt gcacaagaac ctcaagagca gcaacgtcct cctcgacgcc gacttccgcg ccaaggtctc
caacttcggc ctggcgcgca ccgtcgccgg cgccggcggg cagatgacgt cgcgcgtcgt gggtacgcag gggtacatgg
cgccgGAGTA CCTGGAGCAC GGGCTGATCG GGCCTCACCT CGACGTGTTC GCCTTCGGTG TCGTCCTGCT CGAGCTCCTG
TCCGGGAAGG AGGCAGCGCC TGCGCGAGAC GGCGGCGAGG GTGGCGATGG CGAAGCATTG GCGTTGCTGC TGTGGGAGGA
AGCGGAGGGG CAGCTGGTGG TCGACGGCGA CGATGACGAC GCGCGGGGCA AGGTGGCGGC GTTCATGGAC TCCCGGTTGC
GTGGCGACTA CCCGTCGGAG GTGGCTCTCG CGATGGCTGC GCTGGCGCTG CGGTGCGTCG CGCGGGAGCC CCGCGCGCGG
CCGTCGATGG TGGAGGTGTT CCTCTCGCTC TCGGCGTTGC ACGGCACAAC GTTGGATTGG GCCCCCCATG CAACCCTGAG
TTGA

Locus: Os06g0625300

Loading...

Locus: Os06g0625300

Loading...