Os06t0638000-01

Locus

Os06g0638000

Description

CCCH-tandem zinc finger protein, Meiotic cytokinesis, Regulation of gibberellin homeostasis, Control of anther development

RAP-DB Gene Symbol Synonym(s)

DCM1, SAW1

RAP-DB Gene Name Synonym(s)

Defective Callose in Meiosis 1, Swollen Anther Wall 1

CGSNL Gene Symbol

DCM1

CGSNL Gene Name

DEFECTIVE CALLOSE IN MEIOSIS 1

Oryzabase Gene Symbol Synonym(s)

OsDCM1

Oryzabase Gene Name Synonym(s)

defective callose in meiosis 1

Transcript Evidence

Inferred from literature

Protein Evidence

Q67WF0

Literature

PMID: 32149461

PMID: 30419020

Note

Manual Curation

March 10, 2020

Gene Ontology (GO)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Zinc finger, CCCH-type (IPR000571)

Expression Databases

TENOR (Os06t0638000-00)

Others

Oryzabase (22836)

Transcript

6909 bp

>Os06t0638000-01 CCCH-tandem zinc finger protein, Meiotic cytokinesis, Regulation of gibberellin homeostasis, Control of anther development
TCTATCTGGTGGGAATCCCCCACCTGAACCGGTGTAcgcgatcgtcacgactccacgagg
cacccgcgacgacgcagccaccgccgccgGCCGCGATCCACACAGATCCGACCCCACCCA
AACGCGTCCAGATTCCAGCAGCGCAGCCACCCCCACCCAGCCCAGCCGATCCAGCCGTCG
TTGCCGGCCTCGGTAAGCAAAGGATCTCATCAATCCTCACGATTCCCGCAACCCTAGAGC
ATCCCCTTCCCCTTCCCTCGCCTCCAAATTCGCGATTCCTTCCCCCACGAGGCCGAATCC
CTAGGGCCGCCATGGATCCGCCTCCCCCGTTCGACCACCCGCTCCACCGCCGCCACTACT
CCGACCACCACCACTTCCCCCCCGGCGGAAGCGGAGGCAGCGGCGGCGCTGCTTCTGCGG
CTGCGCGCTCCAGGTACGAGTACGGCGGCGGCGGCTACGAGTCCCACTCTCACCACCAGT
ACCACCTCCCTGACCACCACCACCACCACCACCACCACCACCCCCCACCGCGCGTCCAGC
ACCATCACCACCACCACCACCAGCAGCTGCCCGCGCCAACGCCGCCCCCGCCGCCGCCGC
CTCCCCTGCCGCAGCACCGCCTCGAGCCCCCTCCTCCTCACTACGGCTTCCCTCCCCGCG
GCCATCCCGACGCCTACTCGCCGCCGCCGTACCACGACCCGTCCCCGCACCACCACTACC
ATCGCCACGGGGGCGACGACTTCCTCCCCGCCGACGAGATCCGCCGCGTCGGTGGTGGTC
ACCACCACCACCATCACCATCCGCAGCTGCAACAGCTTCTCCCGTGGGAGGAGGCTGAGG
AAGAGAGGCGCCGCTACGGCGGCGCCACCCAGCAGCTCCGACTATCGCCGTCTGGTCCTC
GGAAAAGGCAGCGCTGCGCTGTGCACGACGCCGACGTTGAGAGCACCTCCAGTTCTGGCC
CGCCTCCCCGCCGCCAGAGGCAGCAACCCCACCCGGACTATGCTCTGGATGATAGTTTTG
TAGATAGGAACAATGCCCATCCTGGTTACATGGTCCATGAGGGCTTCTCAATCCACAGTG
ATAGCAAGGTTAGCAGGAAGATCCAGATGCCTACGCAGATGGCACTGCCTGGCTCTCCCC
ATGGCACGAGTGCTGGGTATGCGAGGCGAGCCCCACAGAAGGTTGCCCCTTCTAGAGTGT
CTGTGTGGCACCGAATCGAGGAGAACCCTGCAATGTATGAACCGTCTTCTCCGCCGCCGC
ATATGCCTAAGGAGGTGCACGTCTCGCCGTGCAAGTCGAACAATGTTGCTCCTGCTTCGA
AGGAGTTGGCCAGTGTGATTTCTGTGGATTGTAGAGGGAAGAGTGCTGATGGTAATGATG
GTGATAGTAATACAGGAACAAAGAAGAATCCTGTCAAGAAGAATGAAAAGGTGTTGGCTT
CAGTGCTTGTGAAGCCTCCAATGGAGCCCAAGGAAAAGGAAGTGGCTGCTAAGAAGATGC
TCAAGAAACCTGATAAGGTTCAGAAGAATGCAGTGCATTCCAATATTAGAAGTTTGGTCT
CAACTCCCTGCCCTGGTGCTGGTGCGAAGAAAGTGAAGAAGATAGTTATAAAAAAGATTG
TTAGGAAGATCAATGGGAAAGGTAATCAAAACAGTACCCCGGTTGTCTCAGAAAAGAGAG
ATGGTATTGATGCTAATGCTTGTGAGAAAGAAGAGGGTGAGATCACTACATCATCTTTTG
AGAAGGATGTTATTTCTGCACATGATCCGATCGCCGTTAGTGACACAGCTGGTTTTGGTA
ATGCTGTAAATGATCAGAAGCAAAAAAACACCGACTTCACAAATCCAAGTGGAAGGAATG
CTGCTTCAGCCAATGGATCTATGGAAATTCCCGATCCACCAAATGGTAGTGGGAGTGCAC
ATCCTGGAAAGGAAGAGGTTCTAAGCCCAAAGAATCCAGTTGATAATAGCAATGCTTCTT
TAGTCGTTGAACCTATAGAAGTGCTTGAGAAAAGTGGGACTGAGCATCCTAGGAAGGAGC
ATGATATGAGCTCTATTGGTTCAGGTGTAAATGATGCTTTTGCAGATGCGAACAATCATA
CTCAGAAGGAGGTTGGTGAAATGAATGTCGCAGTTGCAATCAATTCTGTGAGAGTTTCTG
ATGCACGGGAAGTTCCTAGGTGTGATGATTCCAGCATGGAAGAGAGCAAAGTACCTAAGG
ATGTGGATGCAAACATTGCTGTTTGCATGGATGGAGTTGCTTCTAATTGTGATACAACAG
AAGTCTGTGGAAATGAAGATGCAAGGAGGGAATGTGGAAAAAAATTGATTGGCATAAATG
ACGAGAAAGCTTTCCTTTTAAACAATTCTGCCAGAAGTTCTAGTACATCTGATACTTGCA
TGACTGCTGTAGAGGGTGCTCAGAAAAAAGAGGGTATAATTCTCACTGGTTCAAGTGAAA
AGAGCATCGGCTTTTTAGGTGATTCTGTGGGAACTCATAGGACAACAGAATTTGGTGCCA
GTAAGGATGCCCCCAACGAAGGAGATGACATGCCAAGCCATCCTAGTGAAAAGGATTTTA
TGTCATTGAACTCTTGTGGAGGTCTTAATTACACAGAAGTTAGTGAAAAGGAGGATATCC
AGGAGAAAGAGGACAGAGTACCCATGGAATCAATTGTAGCTTGTACTTCTAGTGGAAATG
AGGACATACAAGTGAATGAGGGCAGAAAACCCATGGAGTTAAGTGAAGCTAATGCTTTTA
GTGGAAGCGGGGATAGCCAAGGTAAAGAGTGTAGAATACCCATGGGTTCAAGTGAAACAA
ATACATCTTCCGTGAATCATGTGAATGCTTCTAATGAAAAGGATTTCAGCTTGAGTGAGG
ACACCCAGAAGAAAGAGAGCCACAGGCCCATAGAATCATGTGAAAATACTACTTTTGAAA
TTATGCACCATGAAGAAGCTCCTAGTACAGAAGAGGTTATTACAGGTGTGTCACTTGGGA
GAAAGGTGGCCGAAGGCCCAACGAGGTCAAATGAAAGATGTTCAGGTGCTAGAGGTAATT
CTGCAACTACTTTAAAGTTTGGTTTAGCTTGTGCAACTGAGGATAATCAGATGGAAGATT
TGCTCAACAATAGAACTGCTTTAAATGAAACAGATGATCCTCTTGATGCTGAGGATTCCC
CTGTGTTTGTTCCTCCATCTTCCAGAAATGTAGAAAGTACATATGCATCGCCATTATATG
ATCCTATGGAGGATTCTACCAGTGATGGTATTTTGAATATTGGTTTGGGAAGGAACACTA
CATCTAAGGCAGCAGAACTTTTGGATCTTCATAGAGACCATATTTCTTCTGAGAATGATT
CTTTGATACATTCCCGGGGCACTTCATCTGTATCTGGTAACCGTGAGCAGTCTGTCCCTA
CAGCTTTGACACTTGGTAGCAATATCTATTTTAGTAGTGCGGAAACTGATGATCGGCCTG
AGGAAAGACATGAGCTAGTAGTGGAAGGTCAGCAAGGATTAACTGTTGAGACAACAAGCA
AACTTGATAGCCCTGGCAAAATAGAAGTCCTGAATGGTGCGGGCTTCATCAGTACAGGTA
TTCAAAATTGGCTGAGTTTACCTCCATCAATCAACAGCATGGAGATGTCTGGGCAATTTC
TGAATAATGGTTTTACTGTTAGTAAGGGTAGGCTAGGTTTAGACCAGAGTATGGATGATG
CTACTTCAGTGAGTCAGGATCATGATATTGCACAAGATATGGACCAGCGTGGAAGTGAGG
ATGCTTTCTTTAGTCAGGATCACAGCATTAGGTTATGTGGTAGCAATTTGCCTCATTCAC
ATTTGTTGGCACCCAAAGAGAGCAGCATGAATGGTGAGGATCAGAGTGGCATTGTTCTCA
CAGGTTTGCACCCTAGTAGTTCAGTAAATGTTTTAGGTCACTATGGTTACCAAACAGATG
ATATTCCTGTGGATAACCTGAATAAGCTTCCCTCAGCTTTAGAATCTTCTGATGCTATGG
ATGCAGATCAAGTTTCTTCTCAGGTATGCGTTAATCCAGATCACACCAATGACAGTAATA
CTGAGAATGCTGGGGTTGAGTCAAATGCAAAGCAGGATCTGTTGTCTTCTTGGATTGAAG
CCATTGTATCAGAGGCTAAAAAGGAACACCCACCATGCAAGTCCACTCCGCTCACTGTTG
GCTTGCCAGATAAGTTATTAGAACCAAAGGACAGCGACAGGAAAACATTACTGGAAACAG
TGGTGCCTTCTGCAGTAAAATCTCCTCAGATAAATTTTGCAAGCTCAACACTCCAAAAGG
TAGCTCCTAAACAAGTAACATTGCCTAGTTCATCCCGAGAACCCACTCGAGCAAATCAAA
ATGCAAGGCACAGGACTTGGCATCGTGGCAACATAGCATCTTCTAGTTCATCTTTGCATG
CTTCACAGCCTTTAGGATTACCCCCAAAATTACCACCCAAGAAGAATGACAAAGCTCAAA
ACTCTTATATACGGAAAGGTAATGCTCTTATTAGAAATCCATCAAATGGTAATCATCCTC
ATTCTTCTACAGGTCACGATACTCAAAATAAGTTGAATAAACCTGTGGTAAGGAGAAGCA
TGAACTTTGTAAGGAAAGCTGATACGAAAGACTTAGCAAATTCTAACATCTCAGTTGAAA
GACCCAAGACCCCTCCTTTACCACTTCACACAAAATCCAGCTGCCCTACAACCCTTTTGG
AGCCATTGTCTCAAACTTTGCAGAAACAGCATGGTCATGAAGCTGAAAAGGAGGATCTCA
CTGGGCAGCCAAAGTCAGGCGTTGATAACTCAAGCATCAAAAGTGCACAAAAATCTGAAC
CCTCGGATCCTAGTAAAGTGGTTTATGTTAGGCCCAAATCAAACCAACTGGTTGCTGCAC
AGAGGCAACACCCTATTGATTTAGTCAACAGTCCCACAGATAAGATTCTGTCTCTGCAGG
CACCCATAGCATATGATCTCTATTTAAAGAAAAGGAAAAATCAAATTGTTTTGAGTTCCT
GCTCCCCTTCTGATGGTCTGAGTACCAAAGAAACGTTACCTGCTGAGAATTCAAATTCAG
AAGAGAAGAAAGATCTAATGATTGCATGCTCTATCAGTGGTATCCCTGGGGTAAAGGACA
GACCACAAAAAGCTCTTCAGACAACAAATAATGTGGGGCGTTTCTCTCATGTGTGGACAC
TCAATGGGCAACAGCCACAGAGGAAAGGTTTTATGGGCAGTAGTCATATGAATGCCTTCC
CACGTATACTTCCATGGAAAAGAAAAATATTCTGCAAGAATTTTAGAAGCAGTCACATGT
CGAATGTGAGCTCCATACGAATTGTCAGAAAATTGCTGCAAACAAGGAAGAGAGATATGA
TTTATACTGTCTCAACTGATGGGTTCTCTCTACGGAAATCTGGTGTGTTAAGTGTTGGTG
GATCAAGTTTGAAATGGTCAAGATCCCTTGAGAAGCGTTCTCAAAAGGTCAACAAGGAAG
CTACATTGGCACTCGCTGAAGTTGAAAGAAGGAAAAGGGAGAAACGGAAGCGGCAGTCTC
TCCATGATAAGGGAGATCATCAATTTGAATCTGTCACTGGCAATCAATTAAGAAACAGCC
GCCAATCGTCTTCCGATTTGAGAAAGCCATCGACTTGCAATGAATATGTGCGCGTTAGCA
AAGGTAACCAACTGGTTAGAAATCCGAAGAATGTAATCCGCATGCTAGCAAGTGACAAAG
TTCGATGGAGTTTGCACACTGTGAGATCACGCCTAGCAAAGAAACAACAGTACTGCCAAT
TCTTCACTCGGTTTGGCGAGTGCAAAAAACCCAGGGGCAAATGCCCTTATATTCATGACC
GAGCTAAAGTGACTATATGTACTAAATTTCTTAAAGGATTGTGTTCTAATACTAGTTGCA
AACTGACTCACAAGGTCCTTCCAGAAAGAATGCCAGATTGTTCTTATTTTCTGAGAGGAC
TCTGTACCAACATAGCCTGCCCCTATAGGCATGTGAAAGTGAACTTGAATGCTCCTGTTT
GTGAAGACTTCTTAAAAGGATATTGTGCATATGGTGACGAGTGTCATAAAAAGCACAGCT
ATGTATGTCCTGTCTTCGAGGCAACTGGAGAGTGCCCACAAGGATCTAGATGCAAACTTC
ATCACCCTAAGAGCAAAGTCAAATCCAAGAGCAGAAGACCAGATTTCTTGCAAAACAGTA
GTTGGGGCCGGTATTTTGATGCCAGCATTGACCATCAAGATGAGACAAGGAAAGTTTCTT
TAGACGAAGACGAGAGAGAGAAACCTCAACGTGTTTTCACTGATGGGGATTTGGGCTTTA
TCAGCTTGGATGATGATGCGGATGAAGATGTTACAGCTTTAGATGCGTCAGATGATATAC
CGCTGATGGAATTGGACTCGGGGGATTTAAGTGTGCAGACTGATAATCTTGATGCACTAA
TCAAGCCACTTCGGATCATGAGAACAGCAAGAGTTTGATAGCTAATGCAGTTAGAGGGGA
TATCAGATTTTCAACGCGAAGACTTACCATCTCAACGAACTAATCTAGCCGCTTTGGATC
ATGGTGACAGCAGGAGTTTGACAGGTTCTTTGATTGACCGAGACAGACCAAACTTGATAC
AACAGGATAGGTGCAGTGTTCGAGACAACCGTATATATATAGGGAAGGAAAACAAGTTTC
GTTTTCTTCATTGTTTTTCTACCCTTATTCGGAAGTTCCATTTTTGTTTGTCATGTACAT
ATAGTTATTTTTCTTATGTTTTAGGTTACCTATATTACATGCCAACATCACACAGAGTTA
AGTGTAACGAACAATCATTTACATTGCAGAAGAAAGAAATGGCAATTTATTTAGAATTGC
ATTGTGCAA

CDS

6207 bp

>Os06t0638000-01 CCCH-tandem zinc finger protein, Meiotic cytokinesis, Regulation of gibberellin homeostasis, Control of anther development
ATGGATCCGCCTCCCCCGTTCGACCACCCGCTCCACCGCCGCCACTACTCCGACCACCAC
CACTTCCCCCCCGGCGGAAGCGGAGGCAGCGGCGGCGCTGCTTCTGCGGCTGCGCGCTCC
AGGTACGAGTACGGCGGCGGCGGCTACGAGTCCCACTCTCACCACCAGTACCACCTCCCT
GACCACCACCACCACCACCACCACCACCACCCCCCACCGCGCGTCCAGCACCATCACCAC
CACCACCACCAGCAGCTGCCCGCGCCAACGCCGCCCCCGCCGCCGCCGCCTCCCCTGCCG
CAGCACCGCCTCGAGCCCCCTCCTCCTCACTACGGCTTCCCTCCCCGCGGCCATCCCGAC
GCCTACTCGCCGCCGCCGTACCACGACCCGTCCCCGCACCACCACTACCATCGCCACGGG
GGCGACGACTTCCTCCCCGCCGACGAGATCCGCCGCGTCGGTGGTGGTCACCACCACCAC
CATCACCATCCGCAGCTGCAACAGCTTCTCCCGTGGGAGGAGGCTGAGGAAGAGAGGCGC
CGCTACGGCGGCGCCACCCAGCAGCTCCGACTATCGCCGTCTGGTCCTCGGAAAAGGCAG
CGCTGCGCTGTGCACGACGCCGACGTTGAGAGCACCTCCAGTTCTGGCCCGCCTCCCCGC
CGCCAGAGGCAGCAACCCCACCCGGACTATGCTCTGGATGATAGTTTTGTAGATAGGAAC
AATGCCCATCCTGGTTACATGGTCCATGAGGGCTTCTCAATCCACAGTGATAGCAAGGTT
AGCAGGAAGATCCAGATGCCTACGCAGATGGCACTGCCTGGCTCTCCCCATGGCACGAGT
GCTGGGTATGCGAGGCGAGCCCCACAGAAGGTTGCCCCTTCTAGAGTGTCTGTGTGGCAC
CGAATCGAGGAGAACCCTGCAATGTATGAACCGTCTTCTCCGCCGCCGCATATGCCTAAG
GAGGTGCACGTCTCGCCGTGCAAGTCGAACAATGTTGCTCCTGCTTCGAAGGAGTTGGCC
AGTGTGATTTCTGTGGATTGTAGAGGGAAGAGTGCTGATGGTAATGATGGTGATAGTAAT
ACAGGAACAAAGAAGAATCCTGTCAAGAAGAATGAAAAGGTGTTGGCTTCAGTGCTTGTG
AAGCCTCCAATGGAGCCCAAGGAAAAGGAAGTGGCTGCTAAGAAGATGCTCAAGAAACCT
GATAAGGTTCAGAAGAATGCAGTGCATTCCAATATTAGAAGTTTGGTCTCAACTCCCTGC
CCTGGTGCTGGTGCGAAGAAAGTGAAGAAGATAGTTATAAAAAAGATTGTTAGGAAGATC
AATGGGAAAGGTAATCAAAACAGTACCCCGGTTGTCTCAGAAAAGAGAGATGGTATTGAT
GCTAATGCTTGTGAGAAAGAAGAGGGTGAGATCACTACATCATCTTTTGAGAAGGATGTT
ATTTCTGCACATGATCCGATCGCCGTTAGTGACACAGCTGGTTTTGGTAATGCTGTAAAT
GATCAGAAGCAAAAAAACACCGACTTCACAAATCCAAGTGGAAGGAATGCTGCTTCAGCC
AATGGATCTATGGAAATTCCCGATCCACCAAATGGTAGTGGGAGTGCACATCCTGGAAAG
GAAGAGGTTCTAAGCCCAAAGAATCCAGTTGATAATAGCAATGCTTCTTTAGTCGTTGAA
CCTATAGAAGTGCTTGAGAAAAGTGGGACTGAGCATCCTAGGAAGGAGCATGATATGAGC
TCTATTGGTTCAGGTGTAAATGATGCTTTTGCAGATGCGAACAATCATACTCAGAAGGAG
GTTGGTGAAATGAATGTCGCAGTTGCAATCAATTCTGTGAGAGTTTCTGATGCACGGGAA
GTTCCTAGGTGTGATGATTCCAGCATGGAAGAGAGCAAAGTACCTAAGGATGTGGATGCA
AACATTGCTGTTTGCATGGATGGAGTTGCTTCTAATTGTGATACAACAGAAGTCTGTGGA
AATGAAGATGCAAGGAGGGAATGTGGAAAAAAATTGATTGGCATAAATGACGAGAAAGCT
TTCCTTTTAAACAATTCTGCCAGAAGTTCTAGTACATCTGATACTTGCATGACTGCTGTA
GAGGGTGCTCAGAAAAAAGAGGGTATAATTCTCACTGGTTCAAGTGAAAAGAGCATCGGC
TTTTTAGGTGATTCTGTGGGAACTCATAGGACAACAGAATTTGGTGCCAGTAAGGATGCC
CCCAACGAAGGAGATGACATGCCAAGCCATCCTAGTGAAAAGGATTTTATGTCATTGAAC
TCTTGTGGAGGTCTTAATTACACAGAAGTTAGTGAAAAGGAGGATATCCAGGAGAAAGAG
GACAGAGTACCCATGGAATCAATTGTAGCTTGTACTTCTAGTGGAAATGAGGACATACAA
GTGAATGAGGGCAGAAAACCCATGGAGTTAAGTGAAGCTAATGCTTTTAGTGGAAGCGGG
GATAGCCAAGGTAAAGAGTGTAGAATACCCATGGGTTCAAGTGAAACAAATACATCTTCC
GTGAATCATGTGAATGCTTCTAATGAAAAGGATTTCAGCTTGAGTGAGGACACCCAGAAG
AAAGAGAGCCACAGGCCCATAGAATCATGTGAAAATACTACTTTTGAAATTATGCACCAT
GAAGAAGCTCCTAGTACAGAAGAGGTTATTACAGGTGTGTCACTTGGGAGAAAGGTGGCC
GAAGGCCCAACGAGGTCAAATGAAAGATGTTCAGGTGCTAGAGGTAATTCTGCAACTACT
TTAAAGTTTGGTTTAGCTTGTGCAACTGAGGATAATCAGATGGAAGATTTGCTCAACAAT
AGAACTGCTTTAAATGAAACAGATGATCCTCTTGATGCTGAGGATTCCCCTGTGTTTGTT
CCTCCATCTTCCAGAAATGTAGAAAGTACATATGCATCGCCATTATATGATCCTATGGAG
GATTCTACCAGTGATGGTATTTTGAATATTGGTTTGGGAAGGAACACTACATCTAAGGCA
GCAGAACTTTTGGATCTTCATAGAGACCATATTTCTTCTGAGAATGATTCTTTGATACAT
TCCCGGGGCACTTCATCTGTATCTGGTAACCGTGAGCAGTCTGTCCCTACAGCTTTGACA
CTTGGTAGCAATATCTATTTTAGTAGTGCGGAAACTGATGATCGGCCTGAGGAAAGACAT
GAGCTAGTAGTGGAAGGTCAGCAAGGATTAACTGTTGAGACAACAAGCAAACTTGATAGC
CCTGGCAAAATAGAAGTCCTGAATGGTGCGGGCTTCATCAGTACAGGTATTCAAAATTGG
CTGAGTTTACCTCCATCAATCAACAGCATGGAGATGTCTGGGCAATTTCTGAATAATGGT
TTTACTGTTAGTAAGGGTAGGCTAGGTTTAGACCAGAGTATGGATGATGCTACTTCAGTG
AGTCAGGATCATGATATTGCACAAGATATGGACCAGCGTGGAAGTGAGGATGCTTTCTTT
AGTCAGGATCACAGCATTAGGTTATGTGGTAGCAATTTGCCTCATTCACATTTGTTGGCA
CCCAAAGAGAGCAGCATGAATGGTGAGGATCAGAGTGGCATTGTTCTCACAGGTTTGCAC
CCTAGTAGTTCAGTAAATGTTTTAGGTCACTATGGTTACCAAACAGATGATATTCCTGTG
GATAACCTGAATAAGCTTCCCTCAGCTTTAGAATCTTCTGATGCTATGGATGCAGATCAA
GTTTCTTCTCAGGTATGCGTTAATCCAGATCACACCAATGACAGTAATACTGAGAATGCT
GGGGTTGAGTCAAATGCAAAGCAGGATCTGTTGTCTTCTTGGATTGAAGCCATTGTATCA
GAGGCTAAAAAGGAACACCCACCATGCAAGTCCACTCCGCTCACTGTTGGCTTGCCAGAT
AAGTTATTAGAACCAAAGGACAGCGACAGGAAAACATTACTGGAAACAGTGGTGCCTTCT
GCAGTAAAATCTCCTCAGATAAATTTTGCAAGCTCAACACTCCAAAAGGTAGCTCCTAAA
CAAGTAACATTGCCTAGTTCATCCCGAGAACCCACTCGAGCAAATCAAAATGCAAGGCAC
AGGACTTGGCATCGTGGCAACATAGCATCTTCTAGTTCATCTTTGCATGCTTCACAGCCT
TTAGGATTACCCCCAAAATTACCACCCAAGAAGAATGACAAAGCTCAAAACTCTTATATA
CGGAAAGGTAATGCTCTTATTAGAAATCCATCAAATGGTAATCATCCTCATTCTTCTACA
GGTCACGATACTCAAAATAAGTTGAATAAACCTGTGGTAAGGAGAAGCATGAACTTTGTA
AGGAAAGCTGATACGAAAGACTTAGCAAATTCTAACATCTCAGTTGAAAGACCCAAGACC
CCTCCTTTACCACTTCACACAAAATCCAGCTGCCCTACAACCCTTTTGGAGCCATTGTCT
CAAACTTTGCAGAAACAGCATGGTCATGAAGCTGAAAAGGAGGATCTCACTGGGCAGCCA
AAGTCAGGCGTTGATAACTCAAGCATCAAAAGTGCACAAAAATCTGAACCCTCGGATCCT
AGTAAAGTGGTTTATGTTAGGCCCAAATCAAACCAACTGGTTGCTGCACAGAGGCAACAC
CCTATTGATTTAGTCAACAGTCCCACAGATAAGATTCTGTCTCTGCAGGCACCCATAGCA
TATGATCTCTATTTAAAGAAAAGGAAAAATCAAATTGTTTTGAGTTCCTGCTCCCCTTCT
GATGGTCTGAGTACCAAAGAAACGTTACCTGCTGAGAATTCAAATTCAGAAGAGAAGAAA
GATCTAATGATTGCATGCTCTATCAGTGGTATCCCTGGGGTAAAGGACAGACCACAAAAA
GCTCTTCAGACAACAAATAATGTGGGGCGTTTCTCTCATGTGTGGACACTCAATGGGCAA
CAGCCACAGAGGAAAGGTTTTATGGGCAGTAGTCATATGAATGCCTTCCCACGTATACTT
CCATGGAAAAGAAAAATATTCTGCAAGAATTTTAGAAGCAGTCACATGTCGAATGTGAGC
TCCATACGAATTGTCAGAAAATTGCTGCAAACAAGGAAGAGAGATATGATTTATACTGTC
TCAACTGATGGGTTCTCTCTACGGAAATCTGGTGTGTTAAGTGTTGGTGGATCAAGTTTG
AAATGGTCAAGATCCCTTGAGAAGCGTTCTCAAAAGGTCAACAAGGAAGCTACATTGGCA
CTCGCTGAAGTTGAAAGAAGGAAAAGGGAGAAACGGAAGCGGCAGTCTCTCCATGATAAG
GGAGATCATCAATTTGAATCTGTCACTGGCAATCAATTAAGAAACAGCCGCCAATCGTCT
TCCGATTTGAGAAAGCCATCGACTTGCAATGAATATGTGCGCGTTAGCAAAGGTAACCAA
CTGGTTAGAAATCCGAAGAATGTAATCCGCATGCTAGCAAGTGACAAAGTTCGATGGAGT
TTGCACACTGTGAGATCACGCCTAGCAAAGAAACAACAGTACTGCCAATTCTTCACTCGG
TTTGGCGAGTGCAAAAAACCCAGGGGCAAATGCCCTTATATTCATGACCGAGCTAAAGTG
ACTATATGTACTAAATTTCTTAAAGGATTGTGTTCTAATACTAGTTGCAAACTGACTCAC
AAGGTCCTTCCAGAAAGAATGCCAGATTGTTCTTATTTTCTGAGAGGACTCTGTACCAAC
ATAGCCTGCCCCTATAGGCATGTGAAAGTGAACTTGAATGCTCCTGTTTGTGAAGACTTC
TTAAAAGGATATTGTGCATATGGTGACGAGTGTCATAAAAAGCACAGCTATGTATGTCCT
GTCTTCGAGGCAACTGGAGAGTGCCCACAAGGATCTAGATGCAAACTTCATCACCCTAAG
AGCAAAGTCAAATCCAAGAGCAGAAGACCAGATTTCTTGCAAAACAGTAGTTGGGGCCGG
TATTTTGATGCCAGCATTGACCATCAAGATGAGACAAGGAAAGTTTCTTTAGACGAAGAC
GAGAGAGAGAAACCTCAACGTGTTTTCACTGATGGGGATTTGGGCTTTATCAGCTTGGAT
GATGATGCGGATGAAGATGTTACAGCTTTAGATGCGTCAGATGATATACCGCTGATGGAA
TTGGACTCGGGGGATTTAAGTGTGCAGACTGATAATCTTGATGCACTAATCAAGCCACTT
CGGATCATGAGAACAGCAAGAGTTTGA

Protein

2069 aa

>Os06t0638000-01 CCCH-tandem zinc finger protein, Meiotic cytokinesis, Regulation of gibberellin homeostasis, Control of anther development
MDPPPPFDHPLHRRHYSDHHHFPPGGSGGSGGAASAAARSRYEYGGGGYESHSHHQYHLP
DHHHHHHHHHPPPRVQHHHHHHHQQLPAPTPPPPPPPPLPQHRLEPPPPHYGFPPRGHPD
AYSPPPYHDPSPHHHYHRHGGDDFLPADEIRRVGGGHHHHHHHPQLQQLLPWEEAEEERR
RYGGATQQLRLSPSGPRKRQRCAVHDADVESTSSSGPPPRRQRQQPHPDYALDDSFVDRN
NAHPGYMVHEGFSIHSDSKVSRKIQMPTQMALPGSPHGTSAGYARRAPQKVAPSRVSVWH
RIEENPAMYEPSSPPPHMPKEVHVSPCKSNNVAPASKELASVISVDCRGKSADGNDGDSN
TGTKKNPVKKNEKVLASVLVKPPMEPKEKEVAAKKMLKKPDKVQKNAVHSNIRSLVSTPC
PGAGAKKVKKIVIKKIVRKINGKGNQNSTPVVSEKRDGIDANACEKEEGEITTSSFEKDV
ISAHDPIAVSDTAGFGNAVNDQKQKNTDFTNPSGRNAASANGSMEIPDPPNGSGSAHPGK
EEVLSPKNPVDNSNASLVVEPIEVLEKSGTEHPRKEHDMSSIGSGVNDAFADANNHTQKE
VGEMNVAVAINSVRVSDAREVPRCDDSSMEESKVPKDVDANIAVCMDGVASNCDTTEVCG
NEDARRECGKKLIGINDEKAFLLNNSARSSSTSDTCMTAVEGAQKKEGIILTGSSEKSIG
FLGDSVGTHRTTEFGASKDAPNEGDDMPSHPSEKDFMSLNSCGGLNYTEVSEKEDIQEKE
DRVPMESIVACTSSGNEDIQVNEGRKPMELSEANAFSGSGDSQGKECRIPMGSSETNTSS
VNHVNASNEKDFSLSEDTQKKESHRPIESCENTTFEIMHHEEAPSTEEVITGVSLGRKVA
EGPTRSNERCSGARGNSATTLKFGLACATEDNQMEDLLNNRTALNETDDPLDAEDSPVFV
PPSSRNVESTYASPLYDPMEDSTSDGILNIGLGRNTTSKAAELLDLHRDHISSENDSLIH
SRGTSSVSGNREQSVPTALTLGSNIYFSSAETDDRPEERHELVVEGQQGLTVETTSKLDS
PGKIEVLNGAGFISTGIQNWLSLPPSINSMEMSGQFLNNGFTVSKGRLGLDQSMDDATSV
SQDHDIAQDMDQRGSEDAFFSQDHSIRLCGSNLPHSHLLAPKESSMNGEDQSGIVLTGLH
PSSSVNVLGHYGYQTDDIPVDNLNKLPSALESSDAMDADQVSSQVCVNPDHTNDSNTENA
GVESNAKQDLLSSWIEAIVSEAKKEHPPCKSTPLTVGLPDKLLEPKDSDRKTLLETVVPS
AVKSPQINFASSTLQKVAPKQVTLPSSSREPTRANQNARHRTWHRGNIASSSSSLHASQP
LGLPPKLPPKKNDKAQNSYIRKGNALIRNPSNGNHPHSSTGHDTQNKLNKPVVRRSMNFV
RKADTKDLANSNISVERPKTPPLPLHTKSSCPTTLLEPLSQTLQKQHGHEAEKEDLTGQP
KSGVDNSSIKSAQKSEPSDPSKVVYVRPKSNQLVAAQRQHPIDLVNSPTDKILSLQAPIA
YDLYLKKRKNQIVLSSCSPSDGLSTKETLPAENSNSEEKKDLMIACSISGIPGVKDRPQK
ALQTTNNVGRFSHVWTLNGQQPQRKGFMGSSHMNAFPRILPWKRKIFCKNFRSSHMSNVS
SIRIVRKLLQTRKRDMIYTVSTDGFSLRKSGVLSVGGSSLKWSRSLEKRSQKVNKEATLA
LAEVERRKREKRKRQSLHDKGDHQFESVTGNQLRNSRQSSSDLRKPSTCNEYVRVSKGNQ
LVRNPKNVIRMLASDKVRWSLHTVRSRLAKKQQYCQFFTRFGECKKPRGKCPYIHDRAKV
TICTKFLKGLCSNTSCKLTHKVLPERMPDCSYFLRGLCTNIACPYRHVKVNLNAPVCEDF
LKGYCAYGDECHKKHSYVCPVFEATGECPQGSRCKLHHPKSKVKSKSRRPDFLQNSSWGR
YFDASIDHQDETRKVSLDEDEREKPQRVFTDGDLGFISLDDDADEDVTALDASDDIPLME
LDSGDLSVQTDNLDALIKPLRIMRTARV*

5'UTR

chr06:25918101..25918411 (+ strand) : 311 bp

CDS

chr06:25918412..25923272 (+ strand) : 4861 bp

chr06:25924314..25924509 (+ strand) : 196 bp

chr06:25924609..25924756 (+ strand) : 148 bp

chr06:25925325..25925403 (+ strand) : 79 bp

chr06:25925803..25925890 (+ strand) : 88 bp

chr06:25925982..25926252 (+ strand) : 271 bp

chr06:25926328..25926370 (+ strand) : 43 bp

chr06:25926453..25926556 (+ strand) : 104 bp

chr06:25927026..25927442 (+ strand) : 417 bp

3'UTR

chr06:25927443..25927833 (+ strand) : 391 bp

FASTA

>Os06t0638000-01 class=Sequence position=chr06:25918101..25927833 (+ strand)
TCTATCTGGT GGGAATCCCC CACCTGAACC GGTGTAcgcg atcgtcacga ctccacgagg cacccgcgac gacgcagcca
ccgccgccgG CCGCGATCCA CACAGATCCG ACCCCACCCA AACGCGTCCA GATTCCAGCA GCGCAGCCAC CCCCACCCAG
CCCAGCCGAT CCAGCCGTCG TTGCCGGCCT CGGTAAGCAA AGGATCTCAT CAATCCTCAC GATTCCCGCA ACCCTAGAGC
ATCCCCTTCC CCTTCCCTCG CCTCCAAATT CGCGATTCCT TCCCCCACGA GGCCGAATCC CTAGGGCCGC CATGGATCCG
CCTCCCCCGT TCGACCACCC GCTCCACCGC CGCCACTACT CCGACCACCA CCACTTCCCC CCCGGCGGAA GCGGAGGCAG
CGGCGGCGCT GCTTCTGCGG CTGCGCGCTC CAGGTACGAG TACGGCGGCG GCGGCTACGA GTCCCACTCT CACCACCAGT
ACCACCTCCC TGACCACCAC CACCACCACC ACCACCACCA CCCCCCACCG CGCGTCCAGC ACCATCACCA CCACCACCAC
CAGCAGCTGC CCGCGCCAAC GCCGCCCCCG CCGCCGCCGC CTCCCCTGCC GCAGCACCGC CTCGAGCCCC CTCCTCCTCA
CTACGGCTTC CCTCCCCGCG GCCATCCCGA CGCCTACTCG CCGCCGCCGT ACCACGACCC GTCCCCGCAC CACCACTACC
ATCGCCACGG GGGCGACGAC TTCCTCCCCG CCGACGAGAT CCGCCGCGTC GGTGGTGGTC ACCACCACCA CCATCACCAT
CCGCAGCTGC AACAGCTTCT CCCGTGGGAG GAGGCTGAGG AAGAGAGGCG CCGCTACGGC GGCGCCACCC AGCAGCTCCG
ACTATCGCCG TCTGGTCCTC GGAAAAGGCA GCGCTGCGCT GTGCACGACG CCGACGTTGA GAGCACCTCC AGTTCTGGCC
CGCCTCCCCG CCGCCAGAGG CAGCAACCCC ACCCGGACTA TGCTCTGGAT GATAGTTTTG TAGATAGGAA CAATGCCCAT
CCTGGTTACA TGGTCCATGA GGGCTTCTCA ATCCACAGTG ATAGCAAGGT TAGCAGGAAG ATCCAGATGC CTACGCAGAT
GGCACTGCCT GGCTCTCCCC ATGGCACGAG TGCTGGGTAT GCGAGGCGAG CCCCACAGAA GGTTGCCCCT TCTAGAGTGT
CTGTGTGGCA CCGAATCGAG GAGAACCCTG CAATGTATGA ACCGTCTTCT CCGCCGCCGC ATATGCCTAA GGAGGTGCAC
GTCTCGCCGT GCAAGTCGAA CAATGTTGCT CCTGCTTCGA AGGAGTTGGC CAGTGTGATT TCTGTGGATT GTAGAGGGAA
GAGTGCTGAT GGTAATGATG GTGATAGTAA TACAGGAACA AAGAAGAATC CTGTCAAGAA GAATGAAAAG GTGTTGGCTT
CAGTGCTTGT GAAGCCTCCA ATGGAGCCCA AGGAAAAGGA AGTGGCTGCT AAGAAGATGC TCAAGAAACC TGATAAGGTT
CAGAAGAATG CAGTGCATTC CAATATTAGA AGTTTGGTCT CAACTCCCTG CCCTGGTGCT GGTGCGAAGA AAGTGAAGAA
GATAGTTATA AAAAAGATTG TTAGGAAGAT CAATGGGAAA GGTAATCAAA ACAGTACCCC GGTTGTCTCA GAAAAGAGAG
ATGGTATTGA TGCTAATGCT TGTGAGAAAG AAGAGGGTGA GATCACTACA TCATCTTTTG AGAAGGATGT TATTTCTGCA
CATGATCCGA TCGCCGTTAG TGACACAGCT GGTTTTGGTA ATGCTGTAAA TGATCAGAAG CAAAAAAACA CCGACTTCAC
AAATCCAAGT GGAAGGAATG CTGCTTCAGC CAATGGATCT ATGGAAATTC CCGATCCACC AAATGGTAGT GGGAGTGCAC
ATCCTGGAAA GGAAGAGGTT CTAAGCCCAA AGAATCCAGT TGATAATAGC AATGCTTCTT TAGTCGTTGA ACCTATAGAA
GTGCTTGAGA AAAGTGGGAC TGAGCATCCT AGGAAGGAGC ATGATATGAG CTCTATTGGT TCAGGTGTAA ATGATGCTTT
TGCAGATGCG AACAATCATA CTCAGAAGGA GGTTGGTGAA ATGAATGTCG CAGTTGCAAT CAATTCTGTG AGAGTTTCTG
ATGCACGGGA AGTTCCTAGG TGTGATGATT CCAGCATGGA AGAGAGCAAA GTACCTAAGG ATGTGGATGC AAACATTGCT
GTTTGCATGG ATGGAGTTGC TTCTAATTGT GATACAACAG AAGTCTGTGG AAATGAAGAT GCAAGGAGGG AATGTGGAAA
AAAATTGATT GGCATAAATG ACGAGAAAGC TTTCCTTTTA AACAATTCTG CCAGAAGTTC TAGTACATCT GATACTTGCA
TGACTGCTGT AGAGGGTGCT CAGAAAAAAG AGGGTATAAT TCTCACTGGT TCAAGTGAAA AGAGCATCGG CTTTTTAGGT
GATTCTGTGG GAACTCATAG GACAACAGAA TTTGGTGCCA GTAAGGATGC CCCCAACGAA GGAGATGACA TGCCAAGCCA
TCCTAGTGAA AAGGATTTTA TGTCATTGAA CTCTTGTGGA GGTCTTAATT ACACAGAAGT TAGTGAAAAG GAGGATATCC
AGGAGAAAGA GGACAGAGTA CCCATGGAAT CAATTGTAGC TTGTACTTCT AGTGGAAATG AGGACATACA AGTGAATGAG
GGCAGAAAAC CCATGGAGTT AAGTGAAGCT AATGCTTTTA GTGGAAGCGG GGATAGCCAA GGTAAAGAGT GTAGAATACC
CATGGGTTCA AGTGAAACAA ATACATCTTC CGTGAATCAT GTGAATGCTT CTAATGAAAA GGATTTCAGC TTGAGTGAGG
ACACCCAGAA GAAAGAGAGC CACAGGCCCA TAGAATCATG TGAAAATACT ACTTTTGAAA TTATGCACCA TGAAGAAGCT
CCTAGTACAG AAGAGGTTAT TACAGGTGTG TCACTTGGGA GAAAGGTGGC CGAAGGCCCA ACGAGGTCAA ATGAAAGATG
TTCAGGTGCT AGAGGTAATT CTGCAACTAC TTTAAAGTTT GGTTTAGCTT GTGCAACTGA GGATAATCAG ATGGAAGATT
TGCTCAACAA TAGAACTGCT TTAAATGAAA CAGATGATCC TCTTGATGCT GAGGATTCCC CTGTGTTTGT TCCTCCATCT
TCCAGAAATG TAGAAAGTAC ATATGCATCG CCATTATATG ATCCTATGGA GGATTCTACC AGTGATGGTA TTTTGAATAT
TGGTTTGGGA AGGAACACTA CATCTAAGGC AGCAGAACTT TTGGATCTTC ATAGAGACCA TATTTCTTCT GAGAATGATT
CTTTGATACA TTCCCGGGGC ACTTCATCTG TATCTGGTAA CCGTGAGCAG TCTGTCCCTA CAGCTTTGAC ACTTGGTAGC
AATATCTATT TTAGTAGTGC GGAAACTGAT GATCGGCCTG AGGAAAGACA TGAGCTAGTA GTGGAAGGTC AGCAAGGATT
AACTGTTGAG ACAACAAGCA AACTTGATAG CCCTGGCAAA ATAGAAGTCC TGAATGGTGC GGGCTTCATC AGTACAGGTA
TTCAAAATTG GCTGAGTTTA CCTCCATCAA TCAACAGCAT GGAGATGTCT GGGCAATTTC TGAATAATGG TTTTACTGTT
AGTAAGGGTA GGCTAGGTTT AGACCAGAGT ATGGATGATG CTACTTCAGT GAGTCAGGAT CATGATATTG CACAAGATAT
GGACCAGCGT GGAAGTGAGG ATGCTTTCTT TAGTCAGGAT CACAGCATTA GGTTATGTGG TAGCAATTTG CCTCATTCAC
ATTTGTTGGC ACCCAAAGAG AGCAGCATGA ATGGTGAGGA TCAGAGTGGC ATTGTTCTCA CAGGTTTGCA CCCTAGTAGT
TCAGTAAATG TTTTAGGTCA CTATGGTTAC CAAACAGATG ATATTCCTGT GGATAACCTG AATAAGCTTC CCTCAGCTTT
AGAATCTTCT GATGCTATGG ATGCAGATCA AGTTTCTTCT CAGGTATGCG TTAATCCAGA TCACACCAAT GACAGTAATA
CTGAGAATGC TGGGGTTGAG TCAAATGCAA AGCAGGATCT GTTGTCTTCT TGGATTGAAG CCATTGTATC AGAGGCTAAA
AAGGAACACC CACCATGCAA GTCCACTCCG CTCACTGTTG GCTTGCCAGA TAAGTTATTA GAACCAAAGG ACAGCGACAG
GAAAACATTA CTGGAAACAG TGGTGCCTTC TGCAGTAAAA TCTCCTCAGA TAAATTTTGC AAGCTCAACA CTCCAAAAGG
TAGCTCCTAA ACAAGTAACA TTGCCTAGTT CATCCCGAGA ACCCACTCGA GCAAATCAAA ATGCAAGGCA CAGGACTTGG
CATCGTGGCA ACATAGCATC TTCTAGTTCA TCTTTGCATG CTTCACAGCC TTTAGGATTA CCCCCAAAAT TACCACCCAA
GAAGAATGAC AAAGCTCAAA ACTCTTATAT ACGGAAAGGT AATGCTCTTA TTAGAAATCC ATCAAATGGT AATCATCCTC
ATTCTTCTAC AGGTCACGAT ACTCAAAATA AGTTGAATAA ACCTGTGGTA AGGAGAAGCA TGAACTTTGT AAGGAAAGCT
GATACGAAAG ACTTAGCAAA TTCTAACATC TCAGTTGAAA GACCCAAGAC CCCTCCTTTA CCACTTCACA CAAAATCCAG
CTGCCCTACA ACCCTTTTGG AGCCATTGTC TCAAACTTTG CAGAAACAGC ATGGTCATGA AGCTGAAAAG GAGGATCTCA
CTGGGCAGCC AAAGTCAGGC GTTGATAACT CAAGCATCAA AAGTGCACAA AAATCTGAAC CCTCGGATCC TAGTAAAGTG
GTTTATGTTA GGCCCAAATC AAACCAACTG GTTGCTGCAC AGAGGCAACA CCCTATTGAT TTAGTCAACA GTCCCACAGA
TAAGATTCTG TCTCTGCAGG CACCCATAGC ATATGATCTC TATTTAAAGA AAAGGAAAAA TCAAATTGTT TTGAGTTCCT
GCTCCCCTTC TGATGGTCTG AGTACCAAAG AAACGTTACC TGCTGAGAAT TCAAATTCAG AAGAGAAGAA AGATCTAATG
ATTGCATGCT CTATCAGTGG TATCCCTGGG GTAAAGGACA GACCACAAAA AGGTAATCTA CTGTACAAAC CATTTGTTAC
TTCTTCTTCC TTTGCAAACT TTACCATCTA ATGAAAACCC TAAAATTTCG AAGTTCACTG GAATTTTGTT TTGTAACCAT
AAACAATAAC CACCTTTACA CCTTTGGAAA ACTTATAATG GTCTTCCATT TATTCAAAGT TCAATCAATG AACAGGAACT
ATTTCAGTGT AAGGAACTTT ATCTAAACTT AAAGATAAAA GGTTAAGAAC CATACTCCAA ATGTGAGTTA GAGCCTTACA
GGTTAATAAC CAAATTAGGA TAATGTGGTT TTAAACAAGC CATTTGTTTA ATATCTTAGC CACACTGAAG CTCTAGACAG
GGATCACTAT TCTGGTTATG CTTATTAAAT GATGGCTTTC CATTTTGCTT ATGGTTTCAT CATCCCATTT CTTTACCTTT
TATGGTGTAG CATATGTTTG TTTACTACTA CTATATTATT TTCTTGTGCT ATTTGTTTTC GGTTCTGCTA AATTTGTGGC
GCCACAATTT TACCTTGATT TCAGTCGATT CTTTGACCCA CACGATTGAC GCCGAGATTC GTGCTCTTGT ACATAACCAC
CAGAAATACG ATAACTTCAC CGAGCAGATG TGTTACGTTG GGTACTGCTA CATGCTCGTA CACAGTTGCA CATTGGTCAA
AGTAAGAGAC CGTACGAATG AGAACACGTA ACGAGAGAGG GATAAAATAG TTAGTGTtat ataattactt cctacttaca
ctataattac atgctattta catatgtaat tttagaactt acatatgtaa ttttgagact tacagtgtaa atacattaaa
attacatatg taattttagg gacttacaat gtaaatacat tctgactatt ttttcatgaa aaatatggcg ccatatagat
agatagtcCC TTTGTTTTTG CCTCTTGATC TGTTACTTTG GAGGGTACAG CATTATGTAA ACTGATAATG TAATATTGAA
GCAATGCTAA TCCCTTCGTA CTATATTATA TGCATACACT TCTCTCAATG CAGCTCTTCA GACAACAAAT AATGTGGGGC
GTTTCTCTCA TGTGTGGACA CTCAATGGGC AACAGCCACA GAGGAAAGGT TTTATGGGCA GTAGTCATAT GAATGCCTTC
CCACGTATAC TTCCATGGAA AAGAAAAATA TTCTGCAAGA ATTTTAGAAG CAGTCACATG TCGAATGTGA GCTCCATACG
AATTGTCAGG TAAATATTTC AGTCTGGTCT TTTCTCTGTA CCTATTTCTA TTCATTCACT TTATTGAATT TTCTTACTGG
CATGTCCTGA TCCTCTATAA TTTGATAGAA AATTGCTGCA AACAAGGAAG AGAGATATGA TTTATACTGT CTCAACTGAT
GGGTTCTCTC TACGGAAATC TGGTGTGTTA AGTGTTGGTG GATCAAGTTT GAAATGGTCA AGATCCCTTG AGAAGCGTTC
TCAAAAGGTC AACAAGGTAT TTCACTTCAG TGAAATTTTT GTTCCTAATT TCTTGTTCAG TCATCAACAG AAATGATTCC
AGGAGTTCTA TAATTCTATT CATCTGATCA TGATATCTAG AAGTTTCCAG CTCAGGTTGT GCTGGGTATA CACTTGAGTT
ATTAGAACAA CTATACGATT TTAACACTCT TTCACTGGTT AAACTGTAAG CTCTAAAGAC AGGGATGTTG CAATGAATGC
CCACCTTATG CTGGTGCCTT TTTTTTTTTT AAAAAAAAAC AATGCCTATA TCTATAGCTT TTGGATCCAT CCATCACAAT
CATATTTTAT GATCTGGAGC ATATGACCTG AAGAAATTCT GTTATCTGAT AAATGATGTC GCCCTGCTAA GACTCATTTG
TTTGATACTA CATGAGCATC TGAATTTTAA ATAGTGTAAC CATGGATGGC CTTTTAAAAG ACCATATACT AAAAGCTACA
GGGTGGAGTG ACTGTCCAAT TGCTGCATTT AGAACATCAG TATTAATCTA TGGTGCTTTT ATTCTCATTA TTAAACAAAA
ATCAAATTGC ACTCTGGATT GCAGGAAGCT ACATTGGCAC TCGCTGAAGT TGAAAGAAGG AAAAGGGAGA AACGGAAGCG
GCAGTCTCTC CATGATAAGG GAGGTAATGG TAATGTGTTA ATTTGTGAAT TTGACATGGT TAAACTTTTC TTATTAGTAC
TGATGAAGAA GATTTAACTA GTTCTCAAGT AAAACTCGCA TGCTCCTTCA TGTTAAAATT TCAACTTAAG TTCCAACTTA
CCAAATAAAC ATTTGAGCTG CTATAGACAG AATTGCATTA TGGCATTACT TTATAGAGCA CAAGGAACCT GTTTTGTTAC
TTTAGTTTGA GCACTGTGGC TTATTGATCA CCTTTTTAGG TGCTTACCAT CGATGAGTTC ATATTTCTTG TGGAAACATG
TTTCCTTGAA TTGCCTTTCT CTGCAAACAT ATATTTTACT GATTAATCAT TTTTTTCATT AGCTTTTCTT TGTTTACGCT
CTATGATGTC TTAATTTTGC AGATCATCAA TTTGAATCTG TCACTGGCAA TCAATTAAGA AACAGCCGCC AATCGTCTTC
CGATTTGAGA AAGCCATCGA CTTGCAATGA GTATGTTATG AACACGTGTT GAGTATGTTA TGAACCCTTT TATCATAGAT
ATTCTAATTT GACTCATTCC CTTGTTTTAT GTTTGAAGCA GATATGTGCG CGTTAGCAAA GGTAACCAAC TGGTTAGAAA
TCCGAAGAAT GTAATCCGCA TGCTAGCAAG TGACAAAGTT CGATGGAGTT TGCACACTGT GAGATCACGC CTAGCAAAGA
AACAACAGTA CTGCCAATTC TTCACTCGGT TTGGCGAGTG CAAAAAACCC AGGGGCAAAT GCCCTTATAT TCATGACCGA
GCTAAAGTGA CTATATGTAC TAAATTTCTT AAAGGATTGT GTTCTAATAC TAGTTGCAAA CTGACTCACA AGGTAAGGTC
TTTCTTCTTG ATTCTATACT AATCTTGCAT TGACATTTTT TTTTCATTTC AAGAGCATGT ATTGCAGGTC CTTCCAGAAA
GAATGCCAGA TTGTTCTTAT TTTCTGAGAG GTGATTCATT CCAGTCTAAC GTCATTACTT TCTCTTTCTT CTGCAAAAAA
ATGTCGTGCT TACATTTTGG CATCACATGC AGGACTCTGT ACCAACATAG CCTGCCCCTA TAGGCATGTG AAAGTGAACT
TGAATGCTCC TGTTTGTGAA GACTTCTTAA AAGGATATTG TGCATATGGT GACGAGGTAT GTGATGCTAT CACTAGATAT
CTGCTGATCT TTATCAAATT TCCGCTCGCA GAATCACAGA ATAACGTAGA TGCTTGTTCA GTTTCCTACA TTTTAGCTAA
AGGAGGAATT CAGCATCAGG TGCACAAAAA ACTGTTCAGT GCGATAGGCT GTTCTTATAT TCCATCAATC AAATAATAAC
TCCTTGCGCT TTAAATACTT AGTTGATATA ATCCACTGCA TGAGATTATA GGAGTTCTTT TTCCTGTAAT CTAGGAAGGC
ATGCATCTGA TTGTTCAGTC TACATGGCGT GTCTAGTGTT ATTTAGTGTT GATATATATA ATTAGATGAA AATGATTTTG
CTGGTAGTTT TTTGCCATGT ACCCGTTAGC CTTTTGAACT TTGGGGGCTT TCACAAACCT TTGTGTATTC TGAATAAAGA
TCACTAATCT TTTTCATGAT CTTGAAATAA TTTCTTTACG AGCAGTGTCA TAAAAAGCAC AGCTATGTAT GTCCTGTCTT
CGAGGCAACT GGAGAGTGCC CACAAGGATC TAGATGCAAA CTTCATCACC CTAAGAGCAA AGTCAAATCC AAGAGCAGAA
GACCAGATTT CTTGCAAAAC AGTAGTTGGG GCCGGTATTT TGATGCCAGC ATTGACCATC AAGATGAGAC AAGGAAAGTT
TCTTTAGACG AAGACGAGAG AGAGAAACCT CAACGTGTTT TCACTGATGG GGATTTGGGC TTTATCAGCT TGGATGATGA
TGCGGATGAA GATGTTACAG CTTTAGATGC GTCAGATGAT ATACCGCTGA TGGAATTGGA CTCGGGGGAT TTAAGTGTGC
AGACTGATAA TCTTGATGCA CTAATCAAGC CACTTCGGAT CATGAGAACA GCAAGAGTTT GATAGCTAAT GCAGTTAGAG
GGGATATCAG ATTTTCAACG CGAAGACTTA CCATCTCAAC GAACTAATCT AGCCGCTTTG GATCATGGTG ACAGCAGGAG
TTTGACAGGT TCTTTGATTG ACCGAGACAG ACCAAACTTG ATACAACAGG ATAGGTGCAG TGTTCGAGAC AACCGTATAT
ATATAGGGAA GGAAAACAAG TTTCGTTTTC TTCATTGTTT TTCTACCCTT ATTCGGAAGT TCCATTTTTG TTTGTCATGT
ACATATAGTT ATTTTTCTTA TGTTTTAGGT TACCTATATT ACATGCCAAC ATCACACAGA GTTAAGTGTA ACGAACAATC
ATTTACATTG CAGAAGAAAG AAATGGCAAT TTATTTAGAA TTGCATTGTG CAA