Os06t0644200-01

Locus

Os06g0644200

Description

Vacuolar H+-translocating inorganic pyrophosphatase (V-PPase, EC 3.6.1.1), Cold tolerance

RAP-DB Gene Symbol Synonym(s)

OVP1

RAP-DB Gene Name Synonym(s)

Vacuolar H+-translocating inorganic pyrophosphatase 1, V-PPase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OVP1

Oryzabase Gene Name Synonym(s)

vacuolar H+-pyrophosphatase 1, V-PPase 1, class I V-PPase, vacuolar H-translocating inorganic pyrophosphatase 1

Transcript Evidence

AK099807

Protein Evidence

Q67WN5

Literature

PMID: 20974539

Note

Manual Curation

September 29, 2020

Gene Ontology (GO)

Biological Process: proton transmembrane transport (GO:1902600)

Molecular Function: inorganic diphosphatase activity (GO:0004427)

Molecular Function: pyrophosphate hydrolysis-driven proton transmembrane transporter activity (GO:0009678)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Pyrophosphate-energised proton pump (IPR004131)

Full-length cDNA

J013098H04 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0644200-01)

RiceXPro (AK099807)

Others

Oryzabase (14467)

KEGG (Os06t0644200-01 (EC:3.6.1.1))

Transcript

3196 bp

>Os06t0644200-01 Vacuolar H+-translocating inorganic pyrophosphatase (V-PPase, EC 3.6.1.1), Cold tolerance
TCTCCTCTCCTCCTCCTCTTCGCGTCGAATCCTCCTCCGAGAAGAGGAGAGTACATGAAT
CCTAGCGCGAGGATCTCGCAGGTAGCAATGGCGGCGATACTGCCGGACCTGGCGACGCAG
GTGCTGGTCCCGGCGGCGGCCGTGGTCGGCATCGCGTTCGCGGTGGTGCAGTGGGTGCTG
GTGTCCAAGGTGAAGATGACCGCGGAGCGGCGCGGCGGGGAGGGGTCCCCCGGCGCGGCC
GCCGGGAAGGACGGCGGCGCCGCCAGCGAGTACCTCATCGAGGAGGAGGAGGGGCTCAAC
GAGCACAACGTCGTCGAGAAGTGCTCCGAGATCCAGCACGCCATCTCCGAAGGAGCAACT
TCTTTCCTCTTCACTGAATACAAGTATGTTGGACTATTCATGGGCATTTTCGCGGTCCTG
ATCTTCCTCTTCCTTGGATCTGTTGAGGGATTCAGCACAAAGAGTCAACCTTGCCACTAC
AGCAAGGATAGGATGTGCAAGCCTGCCCTTGCAAATGCTATCTTCAGTACTGTTGCCTTT
GTGCTTGGTGCAGTCACCTCTCTTGTATCTGGTTTCCTTGGAATGAAGATTGCAACTTAT
GCAAATGCCAGGACAACCCTTGAGGCAAGGAAGGGTGTTGGGAAGGCATTCATTACTGCT
TTCCGCTCTGGTGCTGTCATGGGTTTCCTGCTTGCTGCAAGTGGCCTTGTTGTTCTTTAC
ATTGCCATCAACTTGTTCGGAATTTATTATGGTGATGACTGGGAAGGTCTTTTTGAGGCT
ATCACTGGGTATGGTCTTGGTGGTTCTTCTATGGCCCTATTTGGCCGTGTAGGTGGCGGT
ATTTACACGAAAGCTGCTGATGTTGGTGCTGACCTAGTTGGGAAAGTAGAAAGGAATATC
CCTGAAGATGACCCAAGAAACCCAGCTGTCATTGCAGATAATGTTGGTGACAATGTTGGA
GATATTGCTGGAATGGGGTCAGATCTCTTTGGTTCCTATGCTGAGTCATCTTGTGCTGCT
CTTGTCGTTGCTTCAATCTCTTCTTTTGGAATTAACCATGAATTCACTCCTATGCTGTAC
CCGCTCCTGATTAGCTCAGTTGGTATCATTGCTTGTCTGATAACCACACTTTTCGCCACT
GATTTTTTTGAGATCAAGGCTGTTGATGAAATTGAGCCTGCCCTCAAGAAGCAACTTATA
ATTTCCACCGTTGTGATGACGGTTGGCATTGCACTTGTCAGTTGGTTAGGCCTCCCATAT
TCCTTCACAATATTCAACTTTGGTGCCCAGAAGACTGTGTATAACTGGCAACTTTTCTTG
TGTGTGGCGGTTGGTCTTTGGGCTGGACTAATCATCGGATTTGTGACAGAGTATTACACA
AGCAACGCCTACAGCCCTGTCCAAGACGTTGCTGATTCCTGCAGAACCGGAGCTGCTACT
AATGTCATCTTTGGCCTTGCTCTGGGATACAAATCTGTCATTATTCCTATTTTTGCTATT
GCTTTTAGTATTTTCCTCAGCTTCAGCCTTGCCGCAATGTACGGTGTAGCTGTGGCTGCC
CTTGGAATGCTTAGCACAATTGCAACTGGTCTTGCCATTGATGCCTATGGCCCTATCAGT
GACAATGCTGGAGGAATTGCTGAGATGGCTGGCATGAGTCACAGAATTCGTGAGAGAACT
GATGCTCTGGATGCTGCAGGAAACACCACTGCTGCCATCGGGAAGGGTTTCGCCATTGGC
TCGGCAGCCTTGGTGTCTCTTGCCCTCTTTGGTGCCTTTGTGAGCCGTGCCGCCATCTCC
ACTGTCGATGTTCTGACACCTAAAGTTTTCATTGGACTGATTGTTGGTGCTATGCTCCCA
TACTGGTTCTCTGCTATGACCATGAAGAGTGTTGGCAGCGCAGCGCTCAAGATGGTGGAG
GAAGTCCGTAGGCAGTTCAACTCCATCCCTGGGCTCATGGAGGGCACAACCAAGCCTGAC
TACGCAACCTGTGTGAAGATCTCCACTGATGCATCCATCAAGGAGATGATTCCCCCAGGT
GCTCTTGTCATGCTCAGCCCTCTCATTGTTGGGATCTTCTTTGGTGTCGAGACCCTCTCA
GGACTACTTGCTGGTGCTCTCGTTTCTGGTGTTCAGATTGCCATCTCTGCATCAAACACT
GGTGGTGCCTGGGACAACGCAAAGAAGTACATTGAGGCTGGTGCATCTGAGCATGCAAGG
ACCCTGGGCCCGAAAGGCTCAGACTGCCACAAGGCTGCTGTGATCGGCGACACCATTGGG
GATCCTCTCAAGGACACCTCAGGCCCCTCGCTCAACATCCTCATCAAGCTGATGGCTGTC
GAGTCGCTCGTGTTTGCCCCGTTCTTCGCCACCCATGGAGGCATCCTCTTCAAGTGGTTT
TAGATGGTGACGATAGATTTACGAGGACGTTATTTTTGCCAGGAGGGCGCTGGAAATCAT
CCATATATTATAGAGTTCATCGAGTTGACACATATAGTTCCCTCCGTTTCCTATTTGTTA
TTACTGTCTGTCCATCAGTCGATCATGCTAAGCTTATTAGCATCATACCTGTGTCTAGTT
TTTTTGAGTCTGGTAGTTGTAGCCGATGGGAGCAAATCACTGGCCACCTACAGGTTTGGA
CAAGAGTACCTTGAATTTGCGTTTTCCTGTAGGTTGGATGATACGATGATGGTGATGATT
ATTGTACGTGCACGGAATGCACCTGTCTCAGTGAAATTTTCCCGGGAAGGTTCTGCTGTT
TCTTTATGTCCTTGTGGGAATGTTAGGATGATCTTGTACAAAAAAGAAAACAACTCTAGT
GATAGGGGGTGGAGTACATGTGTGCCAACTAAGTTTGAGTTGTCTTGAATTATTGAAGTA
AAATACTTTAGCTAAAATGACGTAGTAGTGCGTGTGCTTGCTTTTGTTTTAAGATAGAGA
ATTATAGTATTATTTTGTATACTATATTTTCCTCCTTTCTTGcttcgttcgtttcatatt
ataagactttctagcagactcacattcatatatatggtaatgaatctaaatatatatgtg
tgcctagatccattaataactatatgaatgtgggcaatgctagaaagttttataatatga
aacggaggtaataATATGAAATGGAGGCAGTATCTTATATTTTCTTTATCCTAAATAAAT
AAATCTAAATTTCTGG

CDS

2349 bp

>Os06t0644200-01 Vacuolar H+-translocating inorganic pyrophosphatase (V-PPase, EC 3.6.1.1), Cold tolerance
ATGAATCCTAGCGCGAGGATCTCGCAGGTAGCAATGGCGGCGATACTGCCGGACCTGGCG
ACGCAGGTGCTGGTCCCGGCGGCGGCCGTGGTCGGCATCGCGTTCGCGGTGGTGCAGTGG
GTGCTGGTGTCCAAGGTGAAGATGACCGCGGAGCGGCGCGGCGGGGAGGGGTCCCCCGGC
GCGGCCGCCGGGAAGGACGGCGGCGCCGCCAGCGAGTACCTCATCGAGGAGGAGGAGGGG
CTCAACGAGCACAACGTCGTCGAGAAGTGCTCCGAGATCCAGCACGCCATCTCCGAAGGA
GCAACTTCTTTCCTCTTCACTGAATACAAGTATGTTGGACTATTCATGGGCATTTTCGCG
GTCCTGATCTTCCTCTTCCTTGGATCTGTTGAGGGATTCAGCACAAAGAGTCAACCTTGC
CACTACAGCAAGGATAGGATGTGCAAGCCTGCCCTTGCAAATGCTATCTTCAGTACTGTT
GCCTTTGTGCTTGGTGCAGTCACCTCTCTTGTATCTGGTTTCCTTGGAATGAAGATTGCA
ACTTATGCAAATGCCAGGACAACCCTTGAGGCAAGGAAGGGTGTTGGGAAGGCATTCATT
ACTGCTTTCCGCTCTGGTGCTGTCATGGGTTTCCTGCTTGCTGCAAGTGGCCTTGTTGTT
CTTTACATTGCCATCAACTTGTTCGGAATTTATTATGGTGATGACTGGGAAGGTCTTTTT
GAGGCTATCACTGGGTATGGTCTTGGTGGTTCTTCTATGGCCCTATTTGGCCGTGTAGGT
GGCGGTATTTACACGAAAGCTGCTGATGTTGGTGCTGACCTAGTTGGGAAAGTAGAAAGG
AATATCCCTGAAGATGACCCAAGAAACCCAGCTGTCATTGCAGATAATGTTGGTGACAAT
GTTGGAGATATTGCTGGAATGGGGTCAGATCTCTTTGGTTCCTATGCTGAGTCATCTTGT
GCTGCTCTTGTCGTTGCTTCAATCTCTTCTTTTGGAATTAACCATGAATTCACTCCTATG
CTGTACCCGCTCCTGATTAGCTCAGTTGGTATCATTGCTTGTCTGATAACCACACTTTTC
GCCACTGATTTTTTTGAGATCAAGGCTGTTGATGAAATTGAGCCTGCCCTCAAGAAGCAA
CTTATAATTTCCACCGTTGTGATGACGGTTGGCATTGCACTTGTCAGTTGGTTAGGCCTC
CCATATTCCTTCACAATATTCAACTTTGGTGCCCAGAAGACTGTGTATAACTGGCAACTT
TTCTTGTGTGTGGCGGTTGGTCTTTGGGCTGGACTAATCATCGGATTTGTGACAGAGTAT
TACACAAGCAACGCCTACAGCCCTGTCCAAGACGTTGCTGATTCCTGCAGAACCGGAGCT
GCTACTAATGTCATCTTTGGCCTTGCTCTGGGATACAAATCTGTCATTATTCCTATTTTT
GCTATTGCTTTTAGTATTTTCCTCAGCTTCAGCCTTGCCGCAATGTACGGTGTAGCTGTG
GCTGCCCTTGGAATGCTTAGCACAATTGCAACTGGTCTTGCCATTGATGCCTATGGCCCT
ATCAGTGACAATGCTGGAGGAATTGCTGAGATGGCTGGCATGAGTCACAGAATTCGTGAG
AGAACTGATGCTCTGGATGCTGCAGGAAACACCACTGCTGCCATCGGGAAGGGTTTCGCC
ATTGGCTCGGCAGCCTTGGTGTCTCTTGCCCTCTTTGGTGCCTTTGTGAGCCGTGCCGCC
ATCTCCACTGTCGATGTTCTGACACCTAAAGTTTTCATTGGACTGATTGTTGGTGCTATG
CTCCCATACTGGTTCTCTGCTATGACCATGAAGAGTGTTGGCAGCGCAGCGCTCAAGATG
GTGGAGGAAGTCCGTAGGCAGTTCAACTCCATCCCTGGGCTCATGGAGGGCACAACCAAG
CCTGACTACGCAACCTGTGTGAAGATCTCCACTGATGCATCCATCAAGGAGATGATTCCC
CCAGGTGCTCTTGTCATGCTCAGCCCTCTCATTGTTGGGATCTTCTTTGGTGTCGAGACC
CTCTCAGGACTACTTGCTGGTGCTCTCGTTTCTGGTGTTCAGATTGCCATCTCTGCATCA
AACACTGGTGGTGCCTGGGACAACGCAAAGAAGTACATTGAGGCTGGTGCATCTGAGCAT
GCAAGGACCCTGGGCCCGAAAGGCTCAGACTGCCACAAGGCTGCTGTGATCGGCGACACC
ATTGGGGATCCTCTCAAGGACACCTCAGGCCCCTCGCTCAACATCCTCATCAAGCTGATG
GCTGTCGAGTCGCTCGTGTTTGCCCCGTTCTTCGCCACCCATGGAGGCATCCTCTTCAAG
TGGTTTTAG

Protein

783 aa

>Os06t0644200-01 Vacuolar H+-translocating inorganic pyrophosphatase (V-PPase, EC 3.6.1.1), Cold tolerance
MNPSARISQVAMAAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPG
AAAGKDGGAASEYLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFA
VLIFLFLGSVEGFSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIA
TYANARTTLEARKGVGKAFITAFRSGAVMGFLLAASGLVVLYIAINLFGIYYGDDWEGLF
EAITGYGLGGSSMALFGRVGGGIYTKAADVGADLVGKVERNIPEDDPRNPAVIADNVGDN
VGDIAGMGSDLFGSYAESSCAALVVASISSFGINHEFTPMLYPLLISSVGIIACLITTLF
ATDFFEIKAVDEIEPALKKQLIISTVVMTVGIALVSWLGLPYSFTIFNFGAQKTVYNWQL
FLCVAVGLWAGLIIGFVTEYYTSNAYSPVQDVADSCRTGAATNVIFGLALGYKSVIIPIF
AIAFSIFLSFSLAAMYGVAVAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRE
RTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLIVGAM
LPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTTKPDYATCVKISTDASIKEMIP
PGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISASNTGGAWDNAKKYIEAGASEH
ARTLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFK
WF*

5'UTR

chr06:26272898..26272951 (+ strand) : 54 bp

CDS

chr06:26272952..26273249 (+ strand) : 298 bp

chr06:26275116..26275690 (+ strand) : 575 bp

chr06:26275853..26276232 (+ strand) : 380 bp

chr06:26276319..26276405 (+ strand) : 87 bp

chr06:26276503..26276833 (+ strand) : 331 bp

chr06:26277004..26277414 (+ strand) : 411 bp

chr06:26277497..26277556 (+ strand) : 60 bp

chr06:26277665..26277871 (+ strand) : 207 bp

3'UTR

chr06:26277872..26278664 (+ strand) : 793 bp

FASTA

>Os06t0644200-01 class=Sequence position=chr06:26272898..26278664 (+ strand)
TCTCCTCTCC TCCTCCTCTT CGCGTCGAAT CCTCCTCCGA GAAGAGGAGA GTACATGAAT CCTAGCGCGA GGATCTCGCA
GGTAGCAATG GCGGCGATAC TGCCGGACCT GGCGACGCAG GTGCTGGTCC CGGCGGCGGC CGTGGTCGGC ATCGCGTTCG
CGGTGGTGCA GTGGGTGCTG GTGTCCAAGG TGAAGATGAC CGCGGAGCGG CGCGGCGGGG AGGGGTCCCC CGGCGCGGCC
GCCGGGAAGG ACGGCGGCGC CGCCAGCGAG TACCTCATCG AGGAGGAGGA GGGGCTCAAC GAGCACAACG TCGTCGAGAA
GTGCTCCGAG ATCCAGCACG CCATCTCCGA AGGTGAGGGA GGGGGACTGA CTCACCCCCG TGTGCTGTTC GTGTTTTTTT
TTTTGGCCTT TTTTGGGTGG ATCTGAGCAC GCGCGTAGTT GTGTAGATCT CGTGCCGTCG CAGCGGTTAC TGGCGCTAAT
TTTTGCTAAT TTAGTTGTTT TTTTTTGGTT GCTTGTGGCG TGAACATGTT CAAAAGTAGC TTATCCGAGC ATCAATTATG
GGGAATTTGC AGCACAAGAT TGATATAATT GTGGGGAATT TGCAGCACAG GATTTATATT TTTATATTGC TGTGAAGAGA
TTATAAAGCT CAGGTTAAGA TGGCGCTGCT TTTAATCAAG CGGAGTTGCG TGTCTAGCAG TAGTGCTTGT GAGCTTGTGT
TACTTTATTT ATTGTGTGAA ATCATGAGAT TCCTCTGAGT TCTATCGAAT TTACTGTGGC TAAAGTAGTA TTCTATTGTG
TGGAATCATG AGATTCCTCT CTGAGTTTGA TTGAATTTAC TGTGTGCCTA AACTATAACG AGAGCTGCTA CACATACGAT
TTTTCACGTA CGATACTTGT ACGACTAACG ATTTCCAGCG AAAGCCCGTA ACGTTTGTCT CCTGTTTTCT AGTGATGCAC
GCACGGCGTT CACCATCAGT TAGAAATCAT ACTAGAATCG TACGCAGAAA TCGTATGCAT AGTATTTTCG AAACTACAAC
TATGCTAGTA TGCTAGATGT GAACTGTTAC ATTGTTAGTT GGATCTACAG AAACATTAAA CAATCATGTT CCCACTTTAC
ACAGCACATG TTATAATAAT TCTTAGTCAG TGCGTGCTAA TCGCGGGTCA ATTAAGTTCG TTTGTTGCGT CTGCTGAGAT
ATTTTATTGG GGAGATATTT TTAGTGGGGT AGATCAGAAC TTGAATTGCT CAGTTCTTAG AGGCCCTCAC GTAAAGCCCT
GCGGTGGCCA TGCTGTGGGG ATAGGAGAAT TTACTGATGG AGGAGGACAA GTTATTGGAC CAGTGGTCCT ACTTATTGCT
CTTAGGAGGA TAAGAAGATA ACGATTTTTC TGCGCACCTG CATTATTGAA GCAGGGAGAA AATAGTTTCA TTTTGACTGT
ATCCACCTAG CTTGGAAGGA ATCCTAGATG CGGCGCACAT GGACGGGACG ATCTTGTGGT CCATTCATTA ATCATAAACC
TTACATGTAA GGTTATAATT CAAGGACAGT TGCAGGCTGA GAGGTGGTGA TTTATGTAGT TTGTCCTATG TTAGGCGCCT
GCTTTCTTGG CAGGTTTCAT CTCTAGCGAT GCTTGGGTGA GTTTTAATAT TGTGAAAGTG TTAGGTTCTG TCCTTTTCTA
GTAAAGTTCA AACGTATTTT TGGAAATATT TGTTTGGTCA ACATTTCTTT CTTAGAAGAC TATAGGGCTT GCAGTTAGTG
TGCCTTACTT GTGGAGTCCT GCTATGCATA TGATCTGTTT CACAGGAAAT GCTAGATATG CTAATAGTTT GCATGGTTTG
TAATTTGTGA ATCTGGTTTT GTGGAAACTT TCTAGGATTG GAACTTTGTT TAATCAAATA CATTTTTGTT GGTTTCAATT
GGTTGGATAT TTGAGATATT GGGTTACTGA CCAGTGACCA AAGTCCCATC TATTTCACTA TTTAATTTAG CCTTTGTTAC
CATATTTTGG TGCTCATGTT TATGGAGTCC AGTCAAACAC TACAATTAGA AAAACAGGTT CAGTTCTAAT TATAAACATA
TTTATGCGTT GCTAGCTTTG GTGTTTTATG TTTCAGCTAT TATTATTGTT ATCGCTAACC TTTTCTTGTC ATTGACTAAT
TGTTGTATAT TTGTATGCGT CTATGATCTA AATACTGTTT TTTTTAAACT GTAAACAGGA GCAACTTCTT TCCTCTTCAC
TGAATACAAG TATGTTGGAC TATTCATGGG CATTTTCGCG GTCCTGATCT TCCTCTTCCT TGGATCTGTT GAGGGATTCA
GCACAAAGAG TCAACCTTGC CACTACAGCA AGGATAGGAT GTGCAAGCCT GCCCTTGCAA ATGCTATCTT CAGTACTGTT
GCCTTTGTGC TTGGTGCAGT CACCTCTCTT GTATCTGGTT TCCTTGGAAT GAAGATTGCA ACTTATGCAA ATGCCAGGAC
AACCCTTGAG GCAAGGAAGG GTGTTGGGAA GGCATTCATT ACTGCTTTCC GCTCTGGTGC TGTCATGGGT TTCCTGCTTG
CTGCAAGTGG CCTTGTTGTT CTTTACATTG CCATCAACTT GTTCGGAATT TATTATGGTG ATGACTGGGA AGGTCTTTTT
GAGGCTATCA CTGGGTATGG TCTTGGTGGT TCTTCTATGG CCCTATTTGG CCGTGTAGGT GGCGGTATTT ACACGAAAGC
TGCTGATGTT GGTGCTGACC TAGTTGGGAA AGTAGAAAGG AATATCCCTG AAGATGACCC AAGAAACCCA GCTGTAAGAA
TTCTTTCCTG ACGCTTTAAA AACTTGTTTC TTAATATTAC TTGAAATAAT TTGTTTTGTT CTTTTCATAA TGATTTGTGT
TATTGAGCAA AGCATTAAAA CATCGATAGG AATTTATGTG CATGCAAGAA TGATCATTTC TTCCTCCTTT TGCAGGTCAT
TGCAGATAAT GTTGGTGACA ATGTTGGAGA TATTGCTGGA ATGGGGTCAG ATCTCTTTGG TTCCTATGCT GAGTCATCTT
GTGCTGCTCT TGTCGTTGCT TCAATCTCTT CTTTTGGAAT TAACCATGAA TTCACTCCTA TGCTGTACCC GCTCCTGATT
AGCTCAGTTG GTATCATTGC TTGTCTGATA ACCACACTTT TCGCCACTGA TTTTTTTGAG ATCAAGGCTG TTGATGAAAT
TGAGCCTGCC CTCAAGAAGC AACTTATAAT TTCCACCGTT GTGATGACGG TTGGCATTGC ACTTGTCAGT TGGTTAGGCC
TCCCATATTC CTTCACAATA TTCAACTTTG GTGCCCAGAA GACTGTGTAT AACTGGTATG CCCATATTTA AATTGGAATT
CCATCTTTTA CTTAGAACTT CATTGTTAAA ATCATTGACC TCATTTCCCT GATTTTGATA GGCAACTTTT CTTGTGTGTG
GCGGTTGGTC TTTGGGCTGG ACTAATCATC GGATTTGTGA CAGAGTATTA CACAAGCAAC GCCTACAGGT GCTTATAAGT
CTGATCATAT TCAATGTTGT CTGTAATCTT ATATATTTGC TTCTAGTCCC TCATGTCCCT CACACCTTGA ATTTCCCTTG
TCCAGCCCTG TCCAAGACGT TGCTGATTCC TGCAGAACCG GAGCTGCTAC TAATGTCATC TTTGGCCTTG CTCTGGGATA
CAAATCTGTC ATTATTCCTA TTTTTGCTAT TGCTTTTAGT ATTTTCCTCA GCTTCAGCCT TGCCGCAATG TACGGTGTAG
CTGTGGCTGC CCTTGGAATG CTTAGCACAA TTGCAACTGG TCTTGCCATT GATGCCTATG GCCCTATCAG TGACAATGCT
GGAGGAATTG CTGAGATGGC TGGCATGAGT CACAGAATTC GTGAGAGAAC TGATGCTCTG GATGCTGCAG GAAACACCAC
TGCTGCCATC GGGAAGGTAA AACTGCTTAT CTTGTCGAAA GTGTTTTTAT GTTGTTTTTA TGCTTCATTT CCACTCTGAA
GTCAATTAAA AATTTAAAAT TGTGTTTGCA CTTGTAAATA TTTTTCCTTT TGTTACAAAT GTCACAATTT TAAAGTTAAT
TCCCATCTCC ATGATTGTAC TTGTAGGGTT TCGCCATTGG CTCGGCAGCC TTGGTGTCTC TTGCCCTCTT TGGTGCCTTT
GTGAGCCGTG CCGCCATCTC CACTGTCGAT GTTCTGACAC CTAAAGTTTT CATTGGACTG ATTGTTGGTG CTATGCTCCC
ATACTGGTTC TCTGCTATGA CCATGAAGAG TGTTGGCAGC GCAGCGCTCA AGATGGTGGA GGAAGTCCGT AGGCAGTTCA
ACTCCATCCC TGGGCTCATG GAGGGCACAA CCAAGCCTGA CTACGCAACC TGTGTGAAGA TCTCCACTGA TGCATCCATC
AAGGAGATGA TTCCCCCAGG TGCTCTTGTC ATGCTCAGCC CTCTCATTGT TGGGATCTTC TTTGGTGTCG AGACCCTCTC
AGGACTACTT GCTGGTGCTC TCGTTTCTGG TGTTCAGGTT CGCACATTCT TTTTCACAGC CACACTCTCA TCACTTACTC
TTGCCATATT GCATTCATAA CCATGTTGCT TCCTTTCAGA TTGCCATCTC TGCATCAAAC ACTGGTGGTG CCTGGGACAA
CGCAAAGAAG TACATTGAGG TAAGAACTTA TCAGCCATCT TCCATCACAG CAACACTTGA CGTCAAGCAG TTTTTTTCCC
CTCCCATATT CGCCAAACAT TATAACTCTC GTTCTCCCTG GTTTTAGGCT GGTGCATCTG AGCATGCAAG GACCCTGGGC
CCGAAAGGCT CAGACTGCCA CAAGGCTGCT GTGATCGGCG ACACCATTGG GGATCCTCTC AAGGACACCT CAGGCCCCTC
GCTCAACATC CTCATCAAGC TGATGGCTGT CGAGTCGCTC GTGTTTGCCC CGTTCTTCGC CACCCATGGA GGCATCCTCT
TCAAGTGGTT TTAGATGGTG ACGATAGATT TACGAGGACG TTATTTTTGC CAGGAGGGCG CTGGAAATCA TCCATATATT
ATAGAGTTCA TCGAGTTGAC ACATATAGTT CCCTCCGTTT CCTATTTGTT ATTACTGTCT GTCCATCAGT CGATCATGCT
AAGCTTATTA GCATCATACC TGTGTCTAGT TTTTTTGAGT CTGGTAGTTG TAGCCGATGG GAGCAAATCA CTGGCCACCT
ACAGGTTTGG ACAAGAGTAC CTTGAATTTG CGTTTTCCTG TAGGTTGGAT GATACGATGA TGGTGATGAT TATTGTACGT
GCACGGAATG CACCTGTCTC AGTGAAATTT TCCCGGGAAG GTTCTGCTGT TTCTTTATGT CCTTGTGGGA ATGTTAGGAT
GATCTTGTAC AAAAAAGAAA ACAACTCTAG TGATAGGGGG TGGAGTACAT GTGTGCCAAC TAAGTTTGAG TTGTCTTGAA
TTATTGAAGT AAAATACTTT AGCTAAAATG ACGTAGTAGT GCGTGTGCTT GCTTTTGTTT TAAGATAGAG AATTATAGTA
TTATTTTGTA TACTATATTT TCCTCCTTTC TTGcttcgtt cgtttcatat tataagactt tctagcagac tcacattcat
atatatggta atgaatctaa atatatatgt gtgcctagat ccattaataa ctatatgaat gtgggcaatg ctagaaagtt
ttataatatg aaacggaggt aataATATGA AATGGAGGCA GTATCTTATA TTTTCTTTAT CCTAAATAAA TAAATCTAAA
TTTCTGG

Locus: Os06g0644200

Loading...

Locus: Os06g0644200

Loading...