Os06t0644200-02

Locus

Os06g0644200

Description

Similar to Vacuolar H+-pyrophosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OVP1

Oryzabase Gene Name Synonym(s)

vacuolar H+-pyrophosphatase 1, V-PPase 1, class I V-PPase, vacuolar H-translocating inorganic pyrophosphatase 1

Transcript Evidence

AK107838 (DDBJ, Best hit)

Protein Evidence

P93409 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-133-H07 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0644200-02)

RiceXPro (AK107838)

Others

Oryzabase (14467)

KEGG (Os06t0644200-02 (EC:3.6.1.1))

Transcript

585 bp

>Os06t0644200-02 Similar to Vacuolar H+-pyrophosphatase.
CTCCTCTCCTCCTCCTCTTCGCGTCGAATCCTCCTCCGAGAAGAGGAGAGTACATGAATC
CTAGCGCGAGGATCTCGCAGGTAGCAATGGCGGCGATACTGCCGGACCTGGCGACGCAGG
TGCTGGTCCCGGCGGCGGCCGTGGTCGGCATCGCGTTCGCGGTGGTGCAGTGGGTGCTGG
TGTCCAAGGTGAAGATGACCGCGGAGCGGCGCGGCGGGGAGGGGTCCCCCGGCGCGGCCG
CCGGGAAGGACGGCGGCGCCGCCAGCGAGTACCTCATCGAGGAGGAGGAGGGGCTCAACG
AGCACAACGTCGTCGAGAAGTGCTCCGAGATCCAGCACGCCATCTCCGAAGGTGAGGGAG
GGGGACTGACTCACCCCCGTGTGCTGTTCGTGTTTTTTTTTTTGGCCTTTTTTGGGTGGA
TCTGAGCACGCGCGTAGTTGTGTAGATCTCGTGCCGTCGCAGCGGTTACTGGCGCTAATT
TTTGCTAATTTAGTTGTTTTTTTTTGGTTGCTTGTGGCGTGAACATGTTCAAAAGTAGCT
TATCCGAGCATCAATTATGGGGAATTTGCAGCACAAGATTGATAT

CDS

372 bp

>Os06t0644200-02 Similar to Vacuolar H+-pyrophosphatase.
ATGAATCCTAGCGCGAGGATCTCGCAGGTAGCAATGGCGGCGATACTGCCGGACCTGGCG
ACGCAGGTGCTGGTCCCGGCGGCGGCCGTGGTCGGCATCGCGTTCGCGGTGGTGCAGTGG
GTGCTGGTGTCCAAGGTGAAGATGACCGCGGAGCGGCGCGGCGGGGAGGGGTCCCCCGGC
GCGGCCGCCGGGAAGGACGGCGGCGCCGCCAGCGAGTACCTCATCGAGGAGGAGGAGGGG
CTCAACGAGCACAACGTCGTCGAGAAGTGCTCCGAGATCCAGCACGCCATCTCCGAAGGT
GAGGGAGGGGGACTGACTCACCCCCGTGTGCTGTTCGTGTTTTTTTTTTTGGCCTTTTTT
GGGTGGATCTGA

Protein

124 aa

>Os06t0644200-02 Similar to Vacuolar H+-pyrophosphatase.
MNPSARISQVAMAAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPG
AAAGKDGGAASEYLIEEEEGLNEHNVVEKCSEIQHAISEGEGGGLTHPRVLFVFFFLAFF
GWI*

5'UTR

chr06:26272899..26272951 (+ strand) : 53 bp

CDS

chr06:26272952..26273323 (+ strand) : 372 bp

3'UTR

chr06:26273324..26273483 (+ strand) : 160 bp

FASTA

>Os06t0644200-02 class=Sequence position=chr06:26272899..26273483 (+ strand)
CTCCTCTCCT CCTCCTCTTC GCGTCGAATC CTCCTCCGAG AAGAGGAGAG TACATGAATC CTAGCGCGAG GATCTCGCAG
GTAGCAATGG CGGCGATACT GCCGGACCTG GCGACGCAGG TGCTGGTCCC GGCGGCGGCC GTGGTCGGCA TCGCGTTCGC
GGTGGTGCAG TGGGTGCTGG TGTCCAAGGT GAAGATGACC GCGGAGCGGC GCGGCGGGGA GGGGTCCCCC GGCGCGGCCG
CCGGGAAGGA CGGCGGCGCC GCCAGCGAGT ACCTCATCGA GGAGGAGGAG GGGCTCAACG AGCACAACGT CGTCGAGAAG
TGCTCCGAGA TCCAGCACGC CATCTCCGAA GGTGAGGGAG GGGGACTGAC TCACCCCCGT GTGCTGTTCG TGTTTTTTTT
TTTGGCCTTT TTTGGGTGGA TCTGAGCACG CGCGTAGTTG TGTAGATCTC GTGCCGTCGC AGCGGTTACT GGCGCTAATT
TTTGCTAATT TAGTTGTTTT TTTTTGGTTG CTTGTGGCGT GAACATGTTC AAAAGTAGCT TATCCGAGCA TCAATTATGG
GGAATTTGCA GCACAAGATT GATAT

Locus: Os06g0644200

Loading...

Locus: Os06g0644200

Loading...