Os06t0644200-03

Locus

Os06g0644200

Description

Similar to Vacuolar H+-pyrophosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OVP1

Oryzabase Gene Name Synonym(s)

vacuolar H+-pyrophosphatase 1, V-PPase 1, class I V-PPase, vacuolar H-translocating inorganic pyrophosphatase 1

Transcript Evidence

AK119631 (DDBJ, Best hit)

Protein Evidence

P93409 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proton transport (GO:0015992)

Cellular Component: membrane (GO:0016020)

Molecular Function: inorganic diphosphatase activity (GO:0004427)

Molecular Function: hydrogen-translocating pyrophosphatase activity (GO:0009678)

Functional domain (InterPro)

Pyrophosphate-energised proton pump (IPR004131)

Full-length cDNA

002-130-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0644200-03)

RiceXPro (AK119631)

Others

Oryzabase (14467)

KEGG (Os06t0644200-03 (EC:3.6.1.1))

Transcript

1674 bp

>Os06t0644200-03 Similar to Vacuolar H+-pyrophosphatase.
TGCTGTACCCGCTCCTGATTAGCTCAGTTGGTATCATTGCTTGTCTGATAACCACACTTT
TCGCCACTGATTTTTTTGAGATCAAGGCTGTTGATGAAATTGAGCCTGCCCTCAAGAAGC
AACTTATAATTTCCACCGTTGTGATGACGGTTGGCATTGCACTTGTCAGTTGGTTAGGCC
TCCCATATTCCTTCACAATATTCAACTTTGGTGCCCAGAAGACTGTGTATAACTGGCAAC
TTTTCTTGTGTGTGGCGGTTGGTCTTTGGGCTGGACTAATCATCGGATTTGTGACAGAGT
ATTACACAAGCAACGCCTACAGCCCTGTCCAAGACGTTGCTGATTCCTGCAGAACCGGAG
CTGCTACTAATGTCATCTTTGGCCTTGCTCTGGGATACAAATCTGTCATTATTCCTATTT
TTGCTATTGCTTTTAGTATTTTCCTCAGCTTCAGCCTTGCCGCAATGTACGGTGTAGCTG
TGGCTGCCCTTGGAATGCTTAGCACAATTGCAACTGGTCTTGCCATTGATGCCTATGGCC
CTATCAGTGACAATGCTGGAGGAATTGCTGAGATGGCTGGCATGAGTCACAGAATTCGTG
AGAGAACTGATGCTCTGGATGCTGCAGGAAACACCACTGCTGCCATCGGGAAGGGTTTCG
CCATTGGCTCGGCAGCCTTGGTGTCTCTTGCCCTCTTTGGTGCCTTTGTGAGCCGTGCCG
CCATCTCCACTGTCGATGTTCTGACACCTAAAGTTTTCATTGGACTGATTGTTGGTGCTA
TGCTCCCATACTGGTTCTCTGCTATGACCATGAAGAGTGTTGGCAGCGCAGCGCTCAAGA
TGGTGGAGGAAGTCCGTAGGCAGTTCAACTCCATCCCTGGGCTCATGGAGGGCACAACCA
AGCCTGACTACGCAACCTGTGTGAAGATCTCCACTGATGCATCCATCAAGGAGATGATTC
CCCCAGGTGCTCTTGTCATGCTCAGCCCTCTCATTGTTGGGATCTTCTTTGGTGTCGAGA
CCCTCTCAGGACTACTTGCTGGTGCTCTCGTTTCTGGTGTTCAGATTGCCATCTCTGCAT
CAAACACTGGTGGTGCCTGGGACAACGCAAAGAAGTACATTGAGGCTGGTGCATCTGAGC
ATGCAAGGACCCTGGGCCCGAAAGGCTCAGACTGCCACAAGGCTGCTGTGATCGGCGACA
CCATTGGGGATCCTCTCAAGGACACCTCAGGCCCCTCGCTCAACATCCTCATCAAGCTGA
TGGCTGTCGAGTCGCTCGTGTTTGCCCCGTTCTTCGCCACCCATGGAGGCATCCTCTTCA
AGTGGTTTTAGATGGTGACGATAGATTTACGAGGACGTTATTTTTGCCAGGAGGGCGCTG
GAAATCATCCATATATTATAGAGTTCATCGAGTTGACACATATAGTTCCCTCCGTTTCCT
ATTTGTTATTACTGTCTGTCCATCAGTCGATCATGCTAAGCTTATTAGCATCATACCTGT
GTCTAGTTTTTTTGAGTCTGGTAGTTGTAGCCGATGGGAGCAAATCACTGGCCACCTACA
GGTTTGGACAAGAGTACCTTGAATTTGCGTTTTCCTGTAGGTTGGATGATACGATGATGG
TGATGATTATTGTACGTGCACGGAATGCACCTGTCTCAGTGAAATTTTCCCGGG

CDS

1329 bp

>Os06t0644200-03 Similar to Vacuolar H+-pyrophosphatase.
CTGTACCCGCTCCTGATTAGCTCAGTTGGTATCATTGCTTGTCTGATAACCACACTTTTC
GCCACTGATTTTTTTGAGATCAAGGCTGTTGATGAAATTGAGCCTGCCCTCAAGAAGCAA
CTTATAATTTCCACCGTTGTGATGACGGTTGGCATTGCACTTGTCAGTTGGTTAGGCCTC
CCATATTCCTTCACAATATTCAACTTTGGTGCCCAGAAGACTGTGTATAACTGGCAACTT
TTCTTGTGTGTGGCGGTTGGTCTTTGGGCTGGACTAATCATCGGATTTGTGACAGAGTAT
TACACAAGCAACGCCTACAGCCCTGTCCAAGACGTTGCTGATTCCTGCAGAACCGGAGCT
GCTACTAATGTCATCTTTGGCCTTGCTCTGGGATACAAATCTGTCATTATTCCTATTTTT
GCTATTGCTTTTAGTATTTTCCTCAGCTTCAGCCTTGCCGCAATGTACGGTGTAGCTGTG
GCTGCCCTTGGAATGCTTAGCACAATTGCAACTGGTCTTGCCATTGATGCCTATGGCCCT
ATCAGTGACAATGCTGGAGGAATTGCTGAGATGGCTGGCATGAGTCACAGAATTCGTGAG
AGAACTGATGCTCTGGATGCTGCAGGAAACACCACTGCTGCCATCGGGAAGGGTTTCGCC
ATTGGCTCGGCAGCCTTGGTGTCTCTTGCCCTCTTTGGTGCCTTTGTGAGCCGTGCCGCC
ATCTCCACTGTCGATGTTCTGACACCTAAAGTTTTCATTGGACTGATTGTTGGTGCTATG
CTCCCATACTGGTTCTCTGCTATGACCATGAAGAGTGTTGGCAGCGCAGCGCTCAAGATG
GTGGAGGAAGTCCGTAGGCAGTTCAACTCCATCCCTGGGCTCATGGAGGGCACAACCAAG
CCTGACTACGCAACCTGTGTGAAGATCTCCACTGATGCATCCATCAAGGAGATGATTCCC
CCAGGTGCTCTTGTCATGCTCAGCCCTCTCATTGTTGGGATCTTCTTTGGTGTCGAGACC
CTCTCAGGACTACTTGCTGGTGCTCTCGTTTCTGGTGTTCAGATTGCCATCTCTGCATCA
AACACTGGTGGTGCCTGGGACAACGCAAAGAAGTACATTGAGGCTGGTGCATCTGAGCAT
GCAAGGACCCTGGGCCCGAAAGGCTCAGACTGCCACAAGGCTGCTGTGATCGGCGACACC
ATTGGGGATCCTCTCAAGGACACCTCAGGCCCCTCGCTCAACATCCTCATCAAGCTGATG
GCTGTCGAGTCGCTCGTGTTTGCCCCGTTCTTCGCCACCCATGGAGGCATCCTCTTCAAG
TGGTTTTAG

Protein

443 aa

>Os06t0644200-03 Similar to Vacuolar H+-pyrophosphatase.
LYPLLISSVGIIACLITTLFATDFFEIKAVDEIEPALKKQLIISTVVMTVGIALVSWLGL
PYSFTIFNFGAQKTVYNWQLFLCVAVGLWAGLIIGFVTEYYTSNAYSPVQDVADSCRTGA
ATNVIFGLALGYKSVIIPIFAIAFSIFLSFSLAAMYGVAVAALGMLSTIATGLAIDAYGP
ISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAA
ISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTTK
PDYATCVKISTDASIKEMIPPGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISAS
NTGGAWDNAKKYIEAGASEHARTLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLM
AVESLVFAPFFATHGGILFKWF*

5'UTR

chr06:26275998..26275999 (+ strand) : 2 bp

CDS

chr06:26276000..26276232 (+ strand) : 233 bp

chr06:26276319..26276405 (+ strand) : 87 bp

chr06:26276503..26276833 (+ strand) : 331 bp

chr06:26277004..26277414 (+ strand) : 411 bp

chr06:26277497..26277556 (+ strand) : 60 bp

chr06:26277665..26277871 (+ strand) : 207 bp

3'UTR

chr06:26277872..26278214 (+ strand) : 343 bp

FASTA

>Os06t0644200-03 class=Sequence position=chr06:26275998..26278214 (+ strand)
TGCTGTACCC GCTCCTGATT AGCTCAGTTG GTATCATTGC TTGTCTGATA ACCACACTTT TCGCCACTGA TTTTTTTGAG
ATCAAGGCTG TTGATGAAAT TGAGCCTGCC CTCAAGAAGC AACTTATAAT TTCCACCGTT GTGATGACGG TTGGCATTGC
ACTTGTCAGT TGGTTAGGCC TCCCATATTC CTTCACAATA TTCAACTTTG GTGCCCAGAA GACTGTGTAT AACTGGTATG
CCCATATTTA AATTGGAATT CCATCTTTTA CTTAGAACTT CATTGTTAAA ATCATTGACC TCATTTCCCT GATTTTGATA
GGCAACTTTT CTTGTGTGTG GCGGTTGGTC TTTGGGCTGG ACTAATCATC GGATTTGTGA CAGAGTATTA CACAAGCAAC
GCCTACAGGT GCTTATAAGT CTGATCATAT TCAATGTTGT CTGTAATCTT ATATATTTGC TTCTAGTCCC TCATGTCCCT
CACACCTTGA ATTTCCCTTG TCCAGCCCTG TCCAAGACGT TGCTGATTCC TGCAGAACCG GAGCTGCTAC TAATGTCATC
TTTGGCCTTG CTCTGGGATA CAAATCTGTC ATTATTCCTA TTTTTGCTAT TGCTTTTAGT ATTTTCCTCA GCTTCAGCCT
TGCCGCAATG TACGGTGTAG CTGTGGCTGC CCTTGGAATG CTTAGCACAA TTGCAACTGG TCTTGCCATT GATGCCTATG
GCCCTATCAG TGACAATGCT GGAGGAATTG CTGAGATGGC TGGCATGAGT CACAGAATTC GTGAGAGAAC TGATGCTCTG
GATGCTGCAG GAAACACCAC TGCTGCCATC GGGAAGGTAA AACTGCTTAT CTTGTCGAAA GTGTTTTTAT GTTGTTTTTA
TGCTTCATTT CCACTCTGAA GTCAATTAAA AATTTAAAAT TGTGTTTGCA CTTGTAAATA TTTTTCCTTT TGTTACAAAT
GTCACAATTT TAAAGTTAAT TCCCATCTCC ATGATTGTAC TTGTAGGGTT TCGCCATTGG CTCGGCAGCC TTGGTGTCTC
TTGCCCTCTT TGGTGCCTTT GTGAGCCGTG CCGCCATCTC CACTGTCGAT GTTCTGACAC CTAAAGTTTT CATTGGACTG
ATTGTTGGTG CTATGCTCCC ATACTGGTTC TCTGCTATGA CCATGAAGAG TGTTGGCAGC GCAGCGCTCA AGATGGTGGA
GGAAGTCCGT AGGCAGTTCA ACTCCATCCC TGGGCTCATG GAGGGCACAA CCAAGCCTGA CTACGCAACC TGTGTGAAGA
TCTCCACTGA TGCATCCATC AAGGAGATGA TTCCCCCAGG TGCTCTTGTC ATGCTCAGCC CTCTCATTGT TGGGATCTTC
TTTGGTGTCG AGACCCTCTC AGGACTACTT GCTGGTGCTC TCGTTTCTGG TGTTCAGGTT CGCACATTCT TTTTCACAGC
CACACTCTCA TCACTTACTC TTGCCATATT GCATTCATAA CCATGTTGCT TCCTTTCAGA TTGCCATCTC TGCATCAAAC
ACTGGTGGTG CCTGGGACAA CGCAAAGAAG TACATTGAGG TAAGAACTTA TCAGCCATCT TCCATCACAG CAACACTTGA
CGTCAAGCAG TTTTTTTCCC CTCCCATATT CGCCAAACAT TATAACTCTC GTTCTCCCTG GTTTTAGGCT GGTGCATCTG
AGCATGCAAG GACCCTGGGC CCGAAAGGCT CAGACTGCCA CAAGGCTGCT GTGATCGGCG ACACCATTGG GGATCCTCTC
AAGGACACCT CAGGCCCCTC GCTCAACATC CTCATCAAGC TGATGGCTGT CGAGTCGCTC GTGTTTGCCC CGTTCTTCGC
CACCCATGGA GGCATCCTCT TCAAGTGGTT TTAGATGGTG ACGATAGATT TACGAGGACG TTATTTTTGC CAGGAGGGCG
CTGGAAATCA TCCATATATT ATAGAGTTCA TCGAGTTGAC ACATATAGTT CCCTCCGTTT CCTATTTGTT ATTACTGTCT
GTCCATCAGT CGATCATGCT AAGCTTATTA GCATCATACC TGTGTCTAGT TTTTTTGAGT CTGGTAGTTG TAGCCGATGG
GAGCAAATCA CTGGCCACCT ACAGGTTTGG ACAAGAGTAC CTTGAATTTG CGTTTTCCTG TAGGTTGGAT GATACGATGA
TGGTGATGAT TATTGTACGT GCACGGAATG CACCTGTCTC AGTGAAATTT TCCCGGG

Locus: Os06g0644200

Loading...

Locus: Os06g0644200

Loading...