Os06t0646600-02

Locus

Os06g0646600

Description

Similar to cDNA, clone: J065162G03, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HOS59

CGSNL Gene Name

HOMEOBOX ORYZA SATIVA59

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Homeobox protein knotted-1-like 11, Homeobox protein HOS59

Transcript Evidence

AK289177 (DDBJ, Best hit)

Protein Evidence

B7F8T4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox (IPR001356)

ELK (IPR005539)

KNOX1 (IPR005540)

KNOX2 (IPR005541)

Homeobox KN domain (IPR008422)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Full-length cDNA

J100024E07 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0646600-02)

Others

Oryzabase (8707)

KEGG (Os06t0646600-02)

Transcript

1457 bp

>Os06t0646600-02 Similar to cDNA, clone: J065162G03, full insert sequence.
CTCCTCCACCTCGCGCGCTGCAGCAGCAGCAGCGGTGCGCGTGATGGCGTTCCACTACCA
GGACCACGCGCTGGCGATGGACGCCGCGGCTGCGGCGGCGGAGACGGGCGGCCACCACCA
CCCTGGGTTCGTCGGGGCGGGAGGAGTTGTGGGGGGAGGAGGAGGAGGAGGGTGGGAGCG
GGAGAAGGCCGCCATCGCGGCGCACCCGCTGTACGAGCGGCTGCTGGAGGCGCACGTCGC
GTGCCTCCGCGTCGCCACCCCCGTCGACCAGCTGCCCCGCATCGACGCGCAGATTGCGGC
GCGCCCCCCGCCGCTGGCCGCCGCCACGGCCGCAGCGGCGGCCGCGGCGGCCGGAGGGGC
GCCGTCCGGCGGCGAGGAGCTCGACCTCTTCATGACCCATTATGTATTGCTCCTTTGTTC
GTTCAAGGAACAACTACAGCAACATGTGCGTGTTCATGCAATGGAAGCAGTAATGGCTTG
CTGGGAACTTGAACAAACTTTACAGAGCCTTACAGGGGCATCTCCTCGTGAAGGTTCTGG
AGCAACTATGTCTGATGACGAAGACAATCAGGTTGATAGTGAGAGCAACATGTTTGATGG
AAATGATGGATCAGATGGTATGGGCTTTGGCCCCTTAATGCTGACGGAGGGCGAGAGATC
ATTAGTTGAGCGTGTACGGCAAGAGCTGAAACATGAGCTTAAACAGGGGTACAGAGAAAA
GCTTGTGGACATTAGGGAAGAGATACTCCGAAAGCGAAGAGCTGGAAAACTCCCAGGAGA
TACAGCGTCTACTTTGAAAGCATGGTGGCAGGCTCACTCTAAATGGCCATACCCAACTGA
GGAGGACAAGGCTCGCTTGGTGCAGGAAACAGGGTTGCAACTAAAACAGATCAATAATTG
GTTTATCAACCAACGTAAACGGAACTGGCACAGCAATCCTGCTTCATCCTCATCAGACAA
AAGCAAGAGAAAAAGGTGATGGCAAGGCCGAGCAATCTTGGTAGAACGTGGTTGGAGAAG
AAGTATATATATGTAAATAATGCATCCATTGTGAAGAATGCCAGTATATTTATTGCTCCC
AAGATGGCGATTCGGACAGAAGCTTCCTGGGGCTAATTTATACGAAAGAAATTATGTCAT
GTTATAATTTTAGTCATGTGAAGCTATAGTGCGTATATATAGTGACTTACCAGAGAGTAG
TTTTTATGTTTGCTGTTGGCTAGTGTGCATTTGTAGTTGGGACGTGCTGGCTGTCTCTCT
ACAGCTCGGTACAACCATGTATTTATAACGTGTTGTGAAGCATATGTTGTAAAATCGTGG
AATGGGAGTGTTCTGCGATCCCCATATGTTGTTGTAATGTTGTATATTGATGACCATGCT
GCAACGGCAGCATGTTTGTAACTCGTTATATCCTCAGGCTCTTGTGTTGTTACAAATTAC
AGAACTATATTGTCTTT

CDS

936 bp

>Os06t0646600-02 Similar to cDNA, clone: J065162G03, full insert sequence.
ATGGCGTTCCACTACCAGGACCACGCGCTGGCGATGGACGCCGCGGCTGCGGCGGCGGAG
ACGGGCGGCCACCACCACCCTGGGTTCGTCGGGGCGGGAGGAGTTGTGGGGGGAGGAGGA
GGAGGAGGGTGGGAGCGGGAGAAGGCCGCCATCGCGGCGCACCCGCTGTACGAGCGGCTG
CTGGAGGCGCACGTCGCGTGCCTCCGCGTCGCCACCCCCGTCGACCAGCTGCCCCGCATC
GACGCGCAGATTGCGGCGCGCCCCCCGCCGCTGGCCGCCGCCACGGCCGCAGCGGCGGCC
GCGGCGGCCGGAGGGGCGCCGTCCGGCGGCGAGGAGCTCGACCTCTTCATGACCCATTAT
GTATTGCTCCTTTGTTCGTTCAAGGAACAACTACAGCAACATGTGCGTGTTCATGCAATG
GAAGCAGTAATGGCTTGCTGGGAACTTGAACAAACTTTACAGAGCCTTACAGGGGCATCT
CCTCGTGAAGGTTCTGGAGCAACTATGTCTGATGACGAAGACAATCAGGTTGATAGTGAG
AGCAACATGTTTGATGGAAATGATGGATCAGATGGTATGGGCTTTGGCCCCTTAATGCTG
ACGGAGGGCGAGAGATCATTAGTTGAGCGTGTACGGCAAGAGCTGAAACATGAGCTTAAA
CAGGGGTACAGAGAAAAGCTTGTGGACATTAGGGAAGAGATACTCCGAAAGCGAAGAGCT
GGAAAACTCCCAGGAGATACAGCGTCTACTTTGAAAGCATGGTGGCAGGCTCACTCTAAA
TGGCCATACCCAACTGAGGAGGACAAGGCTCGCTTGGTGCAGGAAACAGGGTTGCAACTA
AAACAGATCAATAATTGGTTTATCAACCAACGTAAACGGAACTGGCACAGCAATCCTGCT
TCATCCTCATCAGACAAAAGCAAGAGAAAAAGGTGA

Protein

312 aa

>Os06t0646600-02 Similar to cDNA, clone: J065162G03, full insert sequence.
MAFHYQDHALAMDAAAAAAETGGHHHPGFVGAGGVVGGGGGGGWEREKAAIAAHPLYERL
LEAHVACLRVATPVDQLPRIDAQIAARPPPLAAATAAAAAAAAGGAPSGGEELDLFMTHY
VLLLCSFKEQLQQHVRVHAMEAVMACWELEQTLQSLTGASPREGSGATMSDDEDNQVDSE
SNMFDGNDGSDGMGFGPLMLTEGERSLVERVRQELKHELKQGYREKLVDIREEILRKRRA
GKLPGDTASTLKAWWQAHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPA
SSSSDKSKRKR*

5'UTR

chr06:26414733..26414775 (- strand) : 43 bp

CDS

chr06:26414382..26414732 (- strand) : 351 bp

chr06:26413206..26413326 (- strand) : 121 bp

chr06:26412553..26412743 (- strand) : 191 bp

chr06:26412347..26412478 (- strand) : 132 bp

chr06:26412126..26412262 (- strand) : 137 bp

chr06:26412022..26412025 (- strand) : 4 bp

3'UTR

chr06:26411544..26412021 (- strand) : 478 bp

FASTA

>Os06t0646600-02 class=Sequence position=chr06:26411544..26414775 (- strand)
CTCCTCCACC TCGCGCGCTG CAGCAGCAGC AGCGGTGCGC GTGATGGCGT TCCACTACCA GGACCACGCG CTGGCGATGG
ACGCCGCGGC TGCGGCGGCG GAGACGGGCG GCCACCACCA CCCTGGGTTC GTCGGGGCGG GAGGAGTTGT GGGGGGAGGA
GGAGGAGGAG GGTGGGAGCG GGAGAAGGCC GCCATCGCGG CGCACCCGCT GTACGAGCGG CTGCTGGAGG CGCACGTCGC
GTGCCTCCGC GTCGCCACCC CCGTCGACCA GCTGCCCCGC ATCGACGCGC AGATTGCGGC GCGCCCCCCG CCGCTGGCCG
CCGCCACGGC CGCAGCGGCG GCCGCGGCGG CCGGAGGGGC GCCGTCCGGC GGCGAGGAGC TCGACCTCTT CATGGTGAGG
GCTAAATTAT TATTAGTAGT AGTAGTAGTA GTAGCGCCAA TCAAATCCCC CCCTCTCTTT CTCCAGGGCG TTTTACTCTT
ATTTTTGCCA AGCTATGAGG TTTGCGTGGT GTGTCTCTGT ATCGCTTTTG CGATCAAATT CTCCTCGCGT GAGAGTTTCT
TGTACGATTG GTATGTGAAA TATTATTCTG GATGAGCGAT ATCGAAAATT GGGGCTGGAA AGGGAAATGA AATTGGCTTT
TTTTTTTTGA AACCGAAGCC AGGATAAGCT GGTGTTATAT TAAGGAGGAG AGAGTATTTA CAAGAAATTG GCTAGTGGAA
TTAGGAGTGA AATTTGGAAG GAAAAAAATA ATTCTCGAAA ACTCAAGCTT CATTTCATTA AGAAGCAGCA GAAGTATGTA
CAGTACAAGT GTACAACAGA GCGGTCCACA AAGAAGGAAC CCTGTAGAAA AAACATCACC AAAATTTTGA CTTTTGGAAG
GGTTGGATTG ATTTTGTCGG AGTAGCAATG GTTCCGACCA TCGTTTTTGA AATATAGTCC TTTGAATTGA ATATGCTAAA
ATTCATCACT TATTTCTCAT TCCTTGGTGT TTGTTTGCAT CCCTAGTTGG CTAGTTGTTG AAGAAGCTCT AAGTTATACT
TCCATTATCT AGTCCTTGTT TGATTTagat tattgagtgt attattgctg tggattatgt ccttcgtcat agggatacat
taaatatttc aataaataaa cttaacaaat aggttaaaac aagtggtcta agtaagtaat atactagaag aaagattttt
tgagaaaata cttcttttga agcatggagc aaataatccg ttttcagtaa tccggtgaat aagctAAAGG GAACATGGTA
TCAATTAATA TTGTTTCTTG CATACAATTT CTGTTAGCTA AGTTTATGAT CAGTTGCCTC TTTTTTAAAA AGTCATTTTG
TTTATCAGGT ACTCTTCTTT GCTTGGAAAT GACAATCTTC CTAAGGCAAT TTTTTTTACT TAATAAAAAA ATGTTTTTTT
TTCTTGCAGA CCCATTATGT ATTGCTCCTT TGTTCGTTCA AGGAACAACT ACAGCAACAT GTGCGTGTTC ATGCAATGGA
AGCAGTAATG GCTTGCTGGG AACTTGAACA AACTTTACAG AGCCTTACAG GTAGCACAAA AAAATCTAGT TGATATTATT
CAACATGAGA ATAGTGGACT CCTGATTTTA GGAAGAGAAA CTTAAAGTTA TTATTTCTCT CTGTTTAATT CATGCTGATG
TGCACCATTG TGCTACCTTT CGTCCATTTT TTTCCTTCTC CGATATAAAC TTGACCTCAA AGTTTACTCC TTTGTAGGTA
CAAAAAAGTA CAAACTAATT CCACCTTTTC AACCATCATA ATCACATAGC ATTTAACTAG CTTCCTTCAC TCTACCAAAT
ATAGTTTACA TTCTTCAATC GGAATTGAGA TATACCTGTG GTTGAACCTG CAGAAAATAA TGAGTGTTCT GTTTGGGAGA
ACTTTAGTGA TGGACATAGG ACTACTCTCC TAATGGCAAA AGGGAATACA GAAGTAAAAT TTGACCAATA ATCTGGTGTT
TTGCCAATCC TCAGTTGTGA CTCTTACTGC AGGGGCATCT CCTCGTGAAG GTTCTGGAGC AACTATGTCT GATGACGAAG
ACAATCAGGT TGATAGTGAG AGCAACATGT TTGATGGAAA TGATGGATCA GATGGTATGG GCTTTGGCCC CTTAATGCTG
ACGGAGGGCG AGAGATCATT AGTTGAGCGT GTACGGCAAG AGCTGAAACA TGAGCTTAAA CAGGTAAGAT TATGGCCTGA
ATTTTTAGTC GTTTGTATGT TGTTGTATAA ACTTTAAACG AAATTTCAAA TTTCCAGGGG TACAGAGAAA AGCTTGTGGA
CATTAGGGAA GAGATACTCC GAAAGCGAAG AGCTGGAAAA CTCCCAGGAG ATACAGCGTC TACTTTGAAA GCATGGTGGC
AGGCTCACTC TAAATGGCCA TACCCAACTG TATGTCAGCT CACAGATACC ATTATCAGGC CTTCCTGCAT TTCCTTTTCT
ACCACTGATG CTCATGTTTC TTAACCTTTA TAGGAGGAGG ACAAGGCTCG CTTGGTGCAG GAAACAGGGT TGCAACTAAA
ACAGATCAAT AATTGGTTTA TCAACCAACG TAAACGGAAC TGGCACAGCA ATCCTGCTTC ATCCTCATCA GACAAAAGCA
AGAGAAAAAG GTATCGTGTC GTGGACTTCT AACAGAAATT CCTTTTACAT ATTTTTGGTT TCCATTTTCC TGTCTCTGTC
TGTTTATGCC TAGAAAAAGA AGCAATGCAG GTGATGGCAA GGCCGAGCAA TCTTGGTAGA ACGTGGTTGG AGAAGAAGTA
TATATATGTA AATAATGCAT CCATTGTGAA GAATGCCAGT ATATTTATTG CTCCCAAGAT GGCGATTCGG ACAGAAGCTT
CCTGGGGCTA ATTTATACGA AAGAAATTAT GTCATGTTAT AATTTTAGTC ATGTGAAGCT ATAGTGCGTA TATATAGTGA
CTTACCAGAG AGTAGTTTTT ATGTTTGCTG TTGGCTAGTG TGCATTTGTA GTTGGGACGT GCTGGCTGTC TCTCTACAGC
TCGGTACAAC CATGTATTTA TAACGTGTTG TGAAGCATAT GTTGTAAAAT CGTGGAATGG GAGTGTTCTG CGATCCCCAT
ATGTTGTTGT AATGTTGTAT ATTGATGACC ATGCTGCAAC GGCAGCATGT TTGTAACTCG TTATATCCTC AGGCTCTTGT
GTTGTTACAA ATTACAGAAC TATATTGTCT TT

Locus: Os06g0646600

Loading...

Locus: Os06g0646600

Loading...