Os06t0647200-01

Locus

Os06g0647200

Description

Similar to Response regulator.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RR25

CGSNL Gene Name

B-TYPE RESPONSE REGULATOR 5

Oryzabase Gene Symbol Synonym(s)

OsRR25, Rrb3, Orr5, OsRR21, OsRRB3

Oryzabase Gene Name Synonym(s)

B-type response regulator 5, B-type RR 3

Transcript Evidence

AK363760 (DDBJ)

Protein Evidence

A1A6A6 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

CheY-like superfamily (IPR011006)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Expression Databases

TENOR (Os06t0647200-01)

Others

Oryzabase (8152)

Transcript

1779 bp

>Os06t0647200-01 Similar to Response regulator.
ATGGCGGCGACGCAGGCGACGGCCGCCAGAAAATTCCCAGAGGGTTTGCGCGTGCTTGCC
GTCGACGATAGCCCCGTTTGCCTCATGCTCCTGGAGGCGTTGCTTCGCCGGTGCAAGTAC
CAACCGACGATGACGAGGGACGCGGCGACAGCGCTACGGATGCTCCGGGAGAGGCCGGGG
GATTTCGACCTGGTGATTAGCGACGTGCACATGCTGGACATGGACGGCTTCAAGCTTCTC
GAGCTCATCGGCCTTGAGATGGATCTCCCCGTCATCATGCAATCCGCAAATGGGGAGCTT
GAAACTATGATGAAGGGCGTGACCCATGGGGCATGTGACTACTTGGTGAAACCAGTGAGC
CTCAAAGACATCCAGAACATATGGCAACATGTGTGGAGGAAGAGAAAGCTTGACATAAGG
AACCACAATGGCGGTTACAACGACGGCGGTGAGCTGGTTGGCGCGACGCGGACCAAGAGG
AAGTACACAAGGAAGATGAGAAATGATGGAGATAATTATGGTGAGAACAAAGAGAACATG
GATTCAACTCTGAAGAGACAAAGGGTTGTCTGGACACCTGAGCTGCACCGGGACTTTGTC
ATTGCCGTCCATGAGCTTGGAGTTGATCGTGCTGTTCCAAGGAAGATATTGCGGATGATG
AAAGTGGACTACATGACCAGAGAGAATATTGCAAGTCATCTTCAGAAGTATCGGTTATAC
CTGAAAAGGATCAGCACTCAAACAGGCATGGATCCTGATCAATTTCCTGAAAAATGGAAG
TATATGAATGAACTGGATGCTCTGAAAAATTACTGTGAAAATGGGAGATACCGTCTAACC
CCAGCCATTGCCTCCTCAAGCTCGAGCAATCCATTTGCAAGGATGAATTCTGCATCTGCA
TTGGCAACAAATGGCTTTCTGCCCACTCACTCAGTTCAGCTCAAGAACAGCCAGAGAAAC
ATGGCCATGGGGACAGTTGGCCATGGTGGAAGCCCGGGCAACAATCCTGTGTTTCAGCCA
CTGCAGAACTCATCAAATGCAAGAAAGTGCTTCCCATCTGGCCCATCTGGGAGCTCATTT
GCAAACATATCAAATGGCTTGTTTTTGGCGCCAACAAATCAGTTTCCAGTGCAGTACCCT
GAAGTGAATAATCAGCCTTTGGTTCAGATGAATCAATCTTCTACAAACCACTTCAGCACA
ATTGGCAATGATTACCAATTTCCGGACCTTGCAAACTGTAGCAAATACTGGCAACCTACA
GCACCATCGATGTTTCCTGATCTTGGTCACAATGATGGGACATCTTTCCGCCCGTCGCAG
GCGAACATCGCCAATATCAACCAGCTCTCAAGCTTTGCAGCCTCCAGTGGCCAGGAACCG
ATGTTTGGAGATGAACTACATGGTCAAATGTCACCAATCATGAGCACCATATCACTGTCA
GATTTCGATGATCAGATGGGGTCATTCAACATAGGAAACGACACAAGCCCAGCAGAGATG
ATGCATGACAACTTCTCACTTGGTAGTGACTCGAACATCAGTTCTTCAACACCAACTGAT
TCAAGCTTCGGTTCTACATTTCCTGACTTTCATCTCGACAGCCCTGAGATGCCGGCTCAG
ATGCTGAATGGTGGGGATGAAGATGGCATTCTTCTCCCTGTGCTCGATGACACAGTTGAT
CAGCAAGATCTTTTTGATCAACTAGATGAAAACAATGGTAGGGAAAAACTTGgtagtggc
cgatgtgttaggaagggtccctttgaatgtttcttttag

CDS

1779 bp

>Os06t0647200-01 Similar to Response regulator.
ATGGCGGCGACGCAGGCGACGGCCGCCAGAAAATTCCCAGAGGGTTTGCGCGTGCTTGCC
GTCGACGATAGCCCCGTTTGCCTCATGCTCCTGGAGGCGTTGCTTCGCCGGTGCAAGTAC
CAACCGACGATGACGAGGGACGCGGCGACAGCGCTACGGATGCTCCGGGAGAGGCCGGGG
GATTTCGACCTGGTGATTAGCGACGTGCACATGCTGGACATGGACGGCTTCAAGCTTCTC
GAGCTCATCGGCCTTGAGATGGATCTCCCCGTCATCATGCAATCCGCAAATGGGGAGCTT
GAAACTATGATGAAGGGCGTGACCCATGGGGCATGTGACTACTTGGTGAAACCAGTGAGC
CTCAAAGACATCCAGAACATATGGCAACATGTGTGGAGGAAGAGAAAGCTTGACATAAGG
AACCACAATGGCGGTTACAACGACGGCGGTGAGCTGGTTGGCGCGACGCGGACCAAGAGG
AAGTACACAAGGAAGATGAGAAATGATGGAGATAATTATGGTGAGAACAAAGAGAACATG
GATTCAACTCTGAAGAGACAAAGGGTTGTCTGGACACCTGAGCTGCACCGGGACTTTGTC
ATTGCCGTCCATGAGCTTGGAGTTGATCGTGCTGTTCCAAGGAAGATATTGCGGATGATG
AAAGTGGACTACATGACCAGAGAGAATATTGCAAGTCATCTTCAGAAGTATCGGTTATAC
CTGAAAAGGATCAGCACTCAAACAGGCATGGATCCTGATCAATTTCCTGAAAAATGGAAG
TATATGAATGAACTGGATGCTCTGAAAAATTACTGTGAAAATGGGAGATACCGTCTAACC
CCAGCCATTGCCTCCTCAAGCTCGAGCAATCCATTTGCAAGGATGAATTCTGCATCTGCA
TTGGCAACAAATGGCTTTCTGCCCACTCACTCAGTTCAGCTCAAGAACAGCCAGAGAAAC
ATGGCCATGGGGACAGTTGGCCATGGTGGAAGCCCGGGCAACAATCCTGTGTTTCAGCCA
CTGCAGAACTCATCAAATGCAAGAAAGTGCTTCCCATCTGGCCCATCTGGGAGCTCATTT
GCAAACATATCAAATGGCTTGTTTTTGGCGCCAACAAATCAGTTTCCAGTGCAGTACCCT
GAAGTGAATAATCAGCCTTTGGTTCAGATGAATCAATCTTCTACAAACCACTTCAGCACA
ATTGGCAATGATTACCAATTTCCGGACCTTGCAAACTGTAGCAAATACTGGCAACCTACA
GCACCATCGATGTTTCCTGATCTTGGTCACAATGATGGGACATCTTTCCGCCCGTCGCAG
GCGAACATCGCCAATATCAACCAGCTCTCAAGCTTTGCAGCCTCCAGTGGCCAGGAACCG
ATGTTTGGAGATGAACTACATGGTCAAATGTCACCAATCATGAGCACCATATCACTGTCA
GATTTCGATGATCAGATGGGGTCATTCAACATAGGAAACGACACAAGCCCAGCAGAGATG
ATGCATGACAACTTCTCACTTGGTAGTGACTCGAACATCAGTTCTTCAACACCAACTGAT
TCAAGCTTCGGTTCTACATTTCCTGACTTTCATCTCGACAGCCCTGAGATGCCGGCTCAG
ATGCTGAATGGTGGGGATGAAGATGGCATTCTTCTCCCTGTGCTCGATGACACAGTTGAT
CAGCAAGATCTTTTTGATCAACTAGATGAAAACAATGGTAGGGAAAAACTTGgtagtggc
cgatgtgttaggaagggtccctttgaatgtttcttttag

Protein

593 aa

>Os06t0647200-01 Similar to Response regulator.
MAATQATAARKFPEGLRVLAVDDSPVCLMLLEALLRRCKYQPTMTRDAATALRMLRERPG
DFDLVISDVHMLDMDGFKLLELIGLEMDLPVIMQSANGELETMMKGVTHGACDYLVKPVS
LKDIQNIWQHVWRKRKLDIRNHNGGYNDGGELVGATRTKRKYTRKMRNDGDNYGENKENM
DSTLKRQRVVWTPELHRDFVIAVHELGVDRAVPRKILRMMKVDYMTRENIASHLQKYRLY
LKRISTQTGMDPDQFPEKWKYMNELDALKNYCENGRYRLTPAIASSSSSNPFARMNSASA
LATNGFLPTHSVQLKNSQRNMAMGTVGHGGSPGNNPVFQPLQNSSNARKCFPSGPSGSSF
ANISNGLFLAPTNQFPVQYPEVNNQPLVQMNQSSTNHFSTIGNDYQFPDLANCSKYWQPT
APSMFPDLGHNDGTSFRPSQANIANINQLSSFAASSGQEPMFGDELHGQMSPIMSTISLS
DFDDQMGSFNIGNDTSPAEMMHDNFSLGSDSNISSSTPTDSSFGSTFPDFHLDSPEMPAQ
MLNGGDEDGILLPVLDDTVDQQDLFDQLDENNGREKLGSGRCVRKGPFECFF*

CDS

chr06:26450761..26450884 (+ strand) : 124 bp

chr06:26450986..26451138 (+ strand) : 153 bp

chr06:26452581..26452931 (+ strand) : 351 bp

chr06:26453027..26453103 (+ strand) : 77 bp

chr06:26453317..26453712 (+ strand) : 396 bp

chr06:26454019..26454696 (+ strand) : 678 bp

FASTA

>Os06t0647200-01 class=Sequence position=chr06:26450761..26454696 (+ strand)
ATGGCGGCGA CGCAGGCGAC GGCCGCCAGA AAATTCCCAG AGGGTTTGCG CGTGCTTGCC GTCGACGATA GCCCCGTTTG
CCTCATGCTC CTGGAGGCGT TGCTTCGCCG GTGCAAGTAC CAACGTGAGT TCTTGGCTTG TTAGCCGAGT TGTTTAGTTA
GATCTTTTTT TTGTATATAT TTTTTTCTTG TTGTTTGCTT GATTTCTGCG GTGGCCGGGA TGTAGCGACG ATGACGAGGG
ACGCGGCGAC AGCGCTACGG ATGCTCCGGG AGAGGCCGGG GGATTTCGAC CTGGTGATTA GCGACGTGCA CATGCTGGAC
ATGGACGGCT TCAAGCTTCT CGAGCTCATC GGCCTTGAGA TGGATCTCCC CGTCATCAGT AAAACCCCTT CCTTCACACC
AACTTTCCAT TTTTCATGCA TGTCATGGCT TCCCTTTCTT GGTATTTGTC CCTTTTCTCT TGGAAGTAGA TGTCTAAAGA
AGTAGGAAGT GTTGCTTTCA AGTAGATCTG TTGAATGGTT GTTTGTTATA CATTGGATAC CACGTGAGAT CCTGTATATT
TATTGACTTC ACACTCATAC TTGGGCTGAT AGATGGTACT AGGTTGGAGA AAAGTGGTCA CATGTCTATT ATGTGCTTGG
TCTTCACATT CATCAATAAT AATCTGAACA TGTAACGGAA TTTCAGTGGG GATATTATGT CGTTGTTTTA TGATCCGTTA
TAGTTGTTGT TTTGTTGGCG TTACTACTTC CAAGTAGATA AGTAGATAAA TCAAATGGTT TGTCGTACAT TGAATAGTAC
TTGATATTCT GTAAAATTAT TGACTTCATT CATACTTGGG TTGGTAGATA GTAGGTTAGA GAAAAATGGC CATTTGTCTA
TTATGTGCTT GGTCTTTAGA TTCATCAACA ATAATCCAAA CATATGTATA GCGGAATTTC GGTGGATGGA ATATTATGTT
GTCGTTTTAT GGTCCATTGT ACTTGTTCTT TTGTAGGCGT TACTATTTGC AAGTAGATAT ATTGAATGGT TCGTTGTACA
TTGGATAGCA CGTGAGATCA TATAAACTTA TTAACTTCAC CCATACTTGG GCTGATAGAT GGTAGGTTAG AGAAAAATGG
CCACGTGTAT ATTATGTGCT TGGGTTTTAG ATTCATCAAT AATAATCCGA ACATGTAACG GAATTTCGGT GGATGGAATA
TTCTACTGTT GTTTTAGGGT CTGTAGTAGT TATTCTTTTG TTGGTGGTAC TACTTTCAAG TAGATAAATT GAATAGTTTG
TTGTACTTAG ATAGCACGTG AGATCCTATA AATTTATTGA CTTAATTCAT ACTTGGGATG ATAGATGGTA GGTTAGACAA
AAATGGTCAC ATGTCTATTA TGTGCTTGAT CTTTAGATTA ATCTGAACAT ATAACAGAAT TTCAGTGAAT GGAATATTCC
CTTGTCGTTT TATGGTTTGA TATAGTTGTT CTTTTGTTGG TGTTATTGTC GAATCTGCAT TCGTGTAATC GTGTTACATG
TATTGTCCTA TTTTTTCTAT TTAATGTGCA AAATAGTAAA ACCTATATCA TTTGAAACCG TCGAACATAA AAGTGACCAT
AACTGTAGCA TGTCATTGTC TAGCACGTGT GAAATATTTG CTTACAATAA AAGATGGGAA AAACATGTGT AATACCTTAA
ATATATTCAA AAGAACAGAG TCCATATATA ACTAGCATCA TCTACGCCAC ATTTTTTTTC CTGATCCGGA TCCACAGGCA
ACAGTTCATG ATGCCCAGTT TATTGAAACA AATTCTGATT GCTGACTATA CGCTGTGCAG TGCAATCCGC AAATGGGGAG
CTTGAAACTA TGATGAAGGG CGTGACCCAT GGGGCATGTG ACTACTTGGT GAAACCAGTG AGCCTCAAAG ACATCCAGAA
CATATGGCAA CATGTGTGGA GGAAGAGAAA GCTTGACATA AGGAACCACA ATGGCGGTTA CAACGACGGC GGTGAGCTGG
TTGGCGCGAC GCGGACCAAG AGGAAGTACA CAAGGAAGAT GAGAAATGAT GGAGATAATT ATGGTGAGAA CAAAGAGAAC
ATGGATTCAA CTCTGAAGAG ACAAAGGGTT GTCTGGACAC CTGAGCTGCA CCGGGACTTT GTCATTGCCG TCCATGAGCT
TGGAGTTGAT CGTAAGAGCT CATGCATCAT GTCTCAGTTA TCAAACAATC TTTTTCTTTT TTTCAATTTG TCTTAAGCAA
TAAATATTTT GATTATGTGA ATGTAGGTGC TGTTCCAAGG AAGATATTGC GGATGATGAA AGTGGACTAC ATGACCAGAG
AGAATATTGC AAGTCATCTT CAGGTTTATA TCTACACTTA TGTTTAATTT CTATGTTTCT ATAATTAAAG ATATTTGGAT
TACTCTTTTC TGATCGAAAG TGTTCCATAC ATAAACCTTT CATATCTTCT TTTAATGTGT GCACACAACT AGTAATCAAT
TTTTTTGTGA TTTTTTTATT GTTTTCCAAT GAGTATGGAC ACATCTCAAC CATGTGTTTG CCTTTCTTGG TTTCAGAAGT
ATCGGTTATA CCTGAAAAGG ATCAGCACTC AAACAGGCAT GGATCCTGAT CAATTTCCTG AAAAATGGAA GTATATGAAT
GAACTGGATG CTCTGAAAAA TTACTGTGAA AATGGGAGAT ACCGTCTAAC CCCAGCCATT GCCTCCTCAA GCTCGAGCAA
TCCATTTGCA AGGATGAATT CTGCATCTGC ATTGGCAACA AATGGCTTTC TGCCCACTCA CTCAGTTCAG CTCAAGAACA
GCCAGAGAAA CATGGCCATG GGGACAGTTG GCCATGGTGG AAGCCCGGGC AACAATCCTG TGTTTCAGCC ACTGCAGAAC
TCATCAAATG CAAGAAAGTG CTTCCCATCT GGCCCATCTG GGAGCTCATT TGCAAACATA TCAAATGGCT TGGTGTTGGA
TACAGACGAT TCTGGTAGCT CATATGCTGG CATGTTCTGT AAGAGTATGT GGGAGACAAG CAATGGCTCT CCATCTTGCC
ATTCTGGCAA CTCGTCTGCA AACAAGTCAA ATAATGGGGT TTCGGCGCCT GCAAATCAGT TTCAAGTACA GTCAAAGTTT
GGGTTTTCAG CTCTTGCAAA TCAGTTTCCA GTGCAGTCAA ATTGTGGGTT TTCGGCGCCT GCAAATCAGT ATCAAGTGCA
GTCAAATGGT GGGTTTTCGG TGCCTGCAAA CCAGTTTCCA GTGCAGTCAA ATGGTGAGTT TTTGGCGCCA ACAAATCAGT
TTCCAGTGCA GTACCCTGAA GTGAATAATC AGCCTTTGGT TCAGATGAAT CAATCTTCTA CAAACCACTT CAGCACAATT
GGCAATGATT ACCAATTTCC GGACCTTGCA AACTGTAGCA AATACTGGCA ACCTACAGCA CCATCGATGT TTCCTGATCT
TGGTCACAAT GATGGGACAT CTTTCCGCCC GTCGCAGGCG AACATCGCCA ATATCAACCA GCTCTCAAGC TTTGCAGCCT
CCAGTGGCCA GGAACCGATG TTTGGAGATG AACTACATGG TCAAATGTCA CCAATCATGA GCACCATATC ACTGTCAGAT
TTCGATGATC AGATGGGGTC ATTCAACATA GGAAACGACA CAAGCCCAGC AGAGATGATG CATGACAACT TCTCACTTGG
TAGTGACTCG AACATCAGTT CTTCAACACC AACTGATTCA AGCTTCGGTT CTACATTTCC TGACTTTCAT CTCGACAGCC
CTGAGATGCC GGCTCAGATG CTGAATGGTG GGGATGAAGA TGGCATTCTT CTCCCTGTGC TCGATGACAC AGTTGATCAG
CAAGATCTTT TTGATCAACT AGATGAAAAC AATGGTAGGG AAAAACTTGg tagtggccga tgtgttagga agggtccctt
tgaatgtttc ttttag

Locus: Os06g0647200

Loading...

Locus: Os06g0647200

Loading...