Os06t0649000-01

Locus

Os06g0649000

Description

PAMP (pathogen-associated molecular pattern)-responsive transrepressor, Defense response

RAP-DB Gene Symbol Synonym(s)

WRKY28, WRKY GENE 28

RAP-DB Gene Name Synonym(s)

OsWRKY28, Rice WRKY gene28

CGSNL Gene Symbol

WRKY28

CGSNL Gene Name

WRKY GENE 28

Oryzabase Gene Symbol Synonym(s)

OsWRKY28, DLN170, OsDLN170

Oryzabase Gene Name Synonym(s)

Rice WRKY gene28, DLN repressor 170, DLN motif protein 170

Transcript Evidence

AK106282

Protein Evidence

Q67WY4

Literature

PMID: 23462973

Rice WRKY Working Group 2012. Rice 5:3.

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 20, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain (IPR003657)

Full-length cDNA

002-101-A04 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0649000-01)

Others

Oryzabase (6540)

Transcript

1413 bp

>Os06t0649000-01 PAMP (pathogen-associated molecular pattern)-responsive transrepressor, Defense response
ACTAGCTCATGCGCATTTCGGCTCTCGCCTTCTTCGCCTTCTTCTCCTCCTCCTCCTGTT
CTTGATTTTCAGTATATTCAATTCATGGATTCGTGGATTGAGCAGACTTCCCTGAGCTTG
GACCTCAACGTCGGCCTGCCGTCGACGGCGAGGAGATCATCGGCTCCGGCGGCGCCGATT
AAGGTTCTCGTGGAGGAGAACTTCTTGTCCTTCAAGAAGGATCACGAGGTTGAGGCGCTG
GAGGCGGAGCTCCGGCGAGCGAGCGAGGAGAACAAGAAGCTGACCGAGATGCTTCGGGCG
GTGGTGGCCAAGTACACCGAGCTGCAGGGACAGGTCAACGACATGATGTCGGCGGCGGCG
GCGGCGGCGGTCAACGCCGGGAACCACCAGTCGTCGACGTCGGAGGGCGGCTCGGTGTCG
CCATCGAGGAAGCGGATCCGTAGCGTCGACAGCCTCGACGACGCCGCCCACCACCGCAAG
CCATCCCCTCCGTTCGTCGCCGCCGCCGCAGCCGCGGCCTACGCCTCCCCCGACCAGATG
GAGTGCACGTCGGCGGCCGCCGCCGCCGCCGCGAAGCGCGTCGTCCGCGAGGACTGCAAG
CCCAAGGTCTCCAAGCGCTTCGTCCACGCCGACCCCTCCGACCTCAGCCTCGTGGTGAAG
GATGGGTATCAATGGCGGAAGTACGGGCAGAAGGTGACGAAGGACAACCCGTGCCCGCGA
GCCTACTTCAGGTGCTCGTTCGCGCCGGCGTGCCCGGTGAAGAAGAAGGTGCAGCGCAGC
GCCGACGACAACACCGTCCTCGTCGCCACGTACGAGGGCGAGCACAACCACGCCCAGCCG
CCGCACCACGACGCCGGCAGCAAGACCGCCGCCGCCGCCAAGCACTCACAGCACCAGCCG
CCACCGAGCGCCGCCGCCGCCGTCGTCCGGCAGCAGCAAGAGCAGGCGGCGGCGGCCGGG
CCGTCGACGGAGGTGGCGGCGAGGAAGAACCTGGCCGAGCAGATGGCGGCGACGCTGACG
AGGGACCCCGGGTTCAAGGCGGCGCTCGTCACGGCGCTCTCCGGCCGGATCCTCGAGCTC
TCGCCGACCAAGAACTGATCCATCGTTAGAACGCCGATGAACTTTGCTCGATTTAGCTGA
GATCGATCGATCAATTTACACGGTAAAATTTTAGAGTTGATCGATTTGCATGGCTTTGAT
CGGAGTTAGGCTAGAGAGAGAGAGGATTAACTGTGTATATTTAGTGATTGATTTTAATTA
GCTCGCTCTACACGTGCCAAGGTGGCAGTTTAAGCAAAACGTACGATAATTCGTTGCAAT
TTGTAATTCAGCTAGAAGATTAGTGTATTCATGGAGATCTATTCAGAGTCTCCCAGATAT
ATATATAGAGAGAGAGATAGTAGCATTGATGTT

CDS

1014 bp

>Os06t0649000-01 PAMP (pathogen-associated molecular pattern)-responsive transrepressor, Defense response
ATGGATTCGTGGATTGAGCAGACTTCCCTGAGCTTGGACCTCAACGTCGGCCTGCCGTCG
ACGGCGAGGAGATCATCGGCTCCGGCGGCGCCGATTAAGGTTCTCGTGGAGGAGAACTTC
TTGTCCTTCAAGAAGGATCACGAGGTTGAGGCGCTGGAGGCGGAGCTCCGGCGAGCGAGC
GAGGAGAACAAGAAGCTGACCGAGATGCTTCGGGCGGTGGTGGCCAAGTACACCGAGCTG
CAGGGACAGGTCAACGACATGATGTCGGCGGCGGCGGCGGCGGCGGTCAACGCCGGGAAC
CACCAGTCGTCGACGTCGGAGGGCGGCTCGGTGTCGCCATCGAGGAAGCGGATCCGTAGC
GTCGACAGCCTCGACGACGCCGCCCACCACCGCAAGCCATCCCCTCCGTTCGTCGCCGCC
GCCGCAGCCGCGGCCTACGCCTCCCCCGACCAGATGGAGTGCACGTCGGCGGCCGCCGCC
GCCGCCGCGAAGCGCGTCGTCCGCGAGGACTGCAAGCCCAAGGTCTCCAAGCGCTTCGTC
CACGCCGACCCCTCCGACCTCAGCCTCGTGGTGAAGGATGGGTATCAATGGCGGAAGTAC
GGGCAGAAGGTGACGAAGGACAACCCGTGCCCGCGAGCCTACTTCAGGTGCTCGTTCGCG
CCGGCGTGCCCGGTGAAGAAGAAGGTGCAGCGCAGCGCCGACGACAACACCGTCCTCGTC
GCCACGTACGAGGGCGAGCACAACCACGCCCAGCCGCCGCACCACGACGCCGGCAGCAAG
ACCGCCGCCGCCGCCAAGCACTCACAGCACCAGCCGCCACCGAGCGCCGCCGCCGCCGTC
GTCCGGCAGCAGCAAGAGCAGGCGGCGGCGGCCGGGCCGTCGACGGAGGTGGCGGCGAGG
AAGAACCTGGCCGAGCAGATGGCGGCGACGCTGACGAGGGACCCCGGGTTCAAGGCGGCG
CTCGTCACGGCGCTCTCCGGCCGGATCCTCGAGCTCTCGCCGACCAAGAACTGA

Protein

338 aa

>Os06t0649000-01 PAMP (pathogen-associated molecular pattern)-responsive transrepressor, Defense response
MDSWIEQTSLSLDLNVGLPSTARRSSAPAAPIKVLVEENFLSFKKDHEVEALEAELRRAS
EENKKLTEMLRAVVAKYTELQGQVNDMMSAAAAAAVNAGNHQSSTSEGGSVSPSRKRIRS
VDSLDDAAHHRKPSPPFVAAAAAAAYASPDQMECTSAAAAAAAKRVVREDCKPKVSKRFV
HADPSDLSLVVKDGYQWRKYGQKVTKDNPCPRAYFRCSFAPACPVKKKVQRSADDNTVLV
ATYEGEHNHAQPPHHDAGSKTAAAAKHSQHQPPPSAAAAVVRQQQEQAAAAGPSTEVAAR
KNLAEQMAATLTRDPGFKAALVTALSGRILELSPTKN*

5'UTR

chr06:26511523..26511606 (- strand) : 84 bp

CDS

chr06:26511379..26511522 (- strand) : 144 bp

chr06:26510849..26511271 (- strand) : 423 bp

chr06:26510321..26510767 (- strand) : 447 bp

3'UTR

chr06:26510006..26510320 (- strand) : 315 bp

FASTA

>Os06t0649000-01 class=Sequence position=chr06:26510006..26511606 (- strand)
ACTAGCTCAT GCGCATTTCG GCTCTCGCCT TCTTCGCCTT CTTCTCCTCC TCCTCCTGTT CTTGATTTTC AGTATATTCA
ATTCATGGAT TCGTGGATTG AGCAGACTTC CCTGAGCTTG GACCTCAACG TCGGCCTGCC GTCGACGGCG AGGAGATCAT
CGGCTCCGGC GGCGCCGATT AAGGTTCTCG TGGAGGAGAA CTTCTTGTCC TTCAAGAAGG ATCACGAGGT GCGTGGAGAG
ATTGACAGCT GCGACGACAT CGATGAGAAT TTGATTGGGA ATATTGAAAA AAAGTTTGAT TAATTAGTTG TTCGATCTTG
TGTCCATCGA TCCAGGTTGA GGCGCTGGAG GCGGAGCTCC GGCGAGCGAG CGAGGAGAAC AAGAAGCTGA CCGAGATGCT
TCGGGCGGTG GTGGCCAAGT ACACCGAGCT GCAGGGACAG GTCAACGACA TGATGTCGGC GGCGGCGGCG GCGGCGGTCA
ACGCCGGGAA CCACCAGTCG TCGACGTCGG AGGGCGGCTC GGTGTCGCCA TCGAGGAAGC GGATCCGTAG CGTCGACAGC
CTCGACGACG CCGCCCACCA CCGCAAGCCA TCCCCTCCGT TCGTCGCCGC CGCCGCAGCC GCGGCCTACG CCTCCCCCGA
CCAGATGGAG TGCACGTCGG CGGCCGCCGC CGCCGCCGCG AAGCGCGTCG TCCGCGAGGA CTGCAAGCCC AAGGTCTCCA
AGCGCTTCGT CCACGCCGAC CCCTCCGACC TCAGCCTCGT AAGCAACGAA ACAATTAGAT TAATCCATTG ATGAGGTCTC
CTCGTAATTA ACCAACAATT GGTTTTGTAA AACCTTCAGG TGGTGAAGGA TGGGTATCAA TGGCGGAAGT ACGGGCAGAA
GGTGACGAAG GACAACCCGT GCCCGCGAGC CTACTTCAGG TGCTCGTTCG CGCCGGCGTG CCCGGTGAAG AAGAAGGTGC
AGCGCAGCGC CGACGACAAC ACCGTCCTCG TCGCCACGTA CGAGGGCGAG CACAACCACG CCCAGCCGCC GCACCACGAC
GCCGGCAGCA AGACCGCCGC CGCCGCCAAG CACTCACAGC ACCAGCCGCC ACCGAGCGCC GCCGCCGCCG TCGTCCGGCA
GCAGCAAGAG CAGGCGGCGG CGGCCGGGCC GTCGACGGAG GTGGCGGCGA GGAAGAACCT GGCCGAGCAG ATGGCGGCGA
CGCTGACGAG GGACCCCGGG TTCAAGGCGG CGCTCGTCAC GGCGCTCTCC GGCCGGATCC TCGAGCTCTC GCCGACCAAG
AACTGATCCA TCGTTAGAAC GCCGATGAAC TTTGCTCGAT TTAGCTGAGA TCGATCGATC AATTTACACG GTAAAATTTT
AGAGTTGATC GATTTGCATG GCTTTGATCG GAGTTAGGCT AGAGAGAGAG AGGATTAACT GTGTATATTT AGTGATTGAT
TTTAATTAGC TCGCTCTACA CGTGCCAAGG TGGCAGTTTA AGCAAAACGT ACGATAATTC GTTGCAATTT GTAATTCAGC
TAGAAGATTA GTGTATTCAT GGAGATCTAT TCAGAGTCTC CCAGATATAT ATATAGAGAG AGAGATAGTA GCATTGATGT
T

Locus: Os06g0649000

Loading...

Locus: Os06g0649000

Loading...