Os06t0649500-01

Locus

Os06g0649500

Description

WD40 repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-132

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK072591 (DDBJ, Best hit)

Protein Evidence

NP_197897.3 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

TFIID subunit, WD40-associated region (IPR007582)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

G-protein beta WD-40 repeat (IPR020472)

Full-length cDNA

J023133N22 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0649500-01)

RiceXPro (AK072591)

Others

Oryzabase (10813)

KEGG (Os06t0649500-01)

Transcript

2345 bp

>Os06t0649500-01 WD40 repeat-like domain containing protein.
GTCTCGCTGCTCTGAGTCGCGTCGCGTCTCCCTCCCGCGCGACGGATCCGAGAGCCCTAA
ACCCTAGAACTCCCTCGCCCTCGCGTCGGCGCCATGGAGGACGAGGAGATGGAGAAGAAG
GTGCAGCAGTACCTGCAGCGGAAGGGGTTCCGCCTCACCGAGCTCGCGTTGCAGGAGGAG
CGCAACCGCATCTCCACCTCCTCCGTCTCCGACGTCGCGCTCGCCAGGTCGGAAAATGAT
CCGGCAAGATACTATGATGGTTATAGTAAACTAAGAACATGGGCATACAGTTCTCTCGAT
CAGTACAAGCATGAATTACTCCGTGTCCTTTACCCAGTGTTTATCCATTCCTTCATGGAT
CTAGTGGCAGAGGGACATACACAGGAAGCTCGGTCCTTTTTCCACACGTTCCATGAAGAC
CATGAACTGATGCATTCTAGGGATCTCCAGAAACTGGAAGGCATTCTTTCTCCTTCACAT
TTGGAGGAAATGGAACTGGCCAGATCTTTAAGGAAAAATCAATTCAGAATTAAGTTATGT
GAGTATTCATATGAGTTACTCCTCCAGTATCTCCAGAAAACACAAGCTCTTGTGGTTCTT
GGAATAATAAATGAACGCACAACTTTTGACGTATCCCCTGGTCAGCCATCTTTAATCTCT
GATGACACGGATGTTGTTGCTCTAGTTGGAACAAAGAAGGATTTGGCAAAACAAATAAAT
CTGAAGGAGGTGCATTGGGGGTTGCTTGAAGATTCAGTTGAAGAGCGCATGGAGAAAACA
CTTTTAGAATCAGATAAAACTGAAGCAGAAAGCAAGGATGCAGATGCCGAAGATAACAAT
AAGAGAAAATCTTCGGAAGGTGGAAAGCAGGGAGGTTCTGTTAAAAAGGTCAAAAAAGAT
AAGATTGCAGGAGCCACAGGGAAAACCAATAAATCTGAAACAAGCATAGTTTCGGTGGCA
CCTCGTGTGAAACCAGAGCTTACACTTCCAGTGATTCCTGTTGAAGTCGAGCAGTCAATT
CTTGAGGATTTGCGAAACCGTGCACAGTTGAATAGCCTGGCATTGCCATCTGTTAGCTTC
TACACATTCCTTAATACTCATAATGGgctaaattgctcatcaatttCACATGACGGCTCT
TTGGTTGTGGGTGGATTCTCTGACTCATCAGTGAAGGTTTGGGATATGTCAAAGATTGGC
CAACCGCCGAAAACATCTAGTCCACAAGGAGAGAATGGACTTTCCCAGGGTGAGCGCACA
TCAGCATCAGATTATGGAAAAAGACCTTATACATTATTCCAAGGTCATTCTGGACCAGTT
TATTCCGCTGCATTTAGCCCATTCGGAGATTTTCTCTTGTCATCATCCTCAGACTCAACA
ATTCGACTATGGAGTACCAAGTTGAATGCTAATCTTGTTTGCTACAAAGGACACAACTAC
CCTGTTTGGGATGTACAATTTAGCCCAGTTGGTCATTATTTTGCTAGCGCTTCTCATGAC
AGGACTGCTAGAATTTGGTCAATGGATAAAATCCAGCCTTTGCGGATAATGGCTGGACAT
CTCTCTGATGTTGATTGTGTGCAGTGGCATGTTAACTGTAACTACATTGCCACCGGCTCT
AGTGACAAAACTGTAAGATTATGGGATGTTCAAACTGGTGAATGTATACGGATGTTCATT
GGCCATAGGAGTATGGTTTTATCATTGGCTATGTCTCCTGATGGGCGATACATGGCCTCC
GGAGATGAAGATGGAACCATCATGATGTGGGATCTCTCTTCTGGTCGGTGCGTTTCACCA
CTTGGGGGACACAGCTCTTGTGTGTGGTCACTTGCTTACAGTTGTGAAGGGGCATTGCTT
GCATCTGGATCAGCCGACTGCACTGTGAAACTCTGGGATGTTGCCTCCAGCACGAAGGTC
CTTAAGACAGATGATACCTCAACTAACCGGCTGAGGATGCTCAAAACTCTCCGTACAAAA
TCAACTCCTGTTTATACTCTGCGGTTTTCTCGGCGAAATCTTTTATTTGCGGCTGGTGCT
CTCTCACTTGGCTCCTAAGCTTCTGTATGTTCTGTAGAATACAACTACCAAACATTCTTT
CAGTTTTATCTCAAGTGAAGTTAGTGCCTAGTGAGTAGTGAGCCTGCTTTTAAGGTTAAT
CTGTAGCACGCGCGTATTGTAATTCGTTCCAATGTTTGTTGTCTTGTGACTTTGTAAGTT
GTAACAATCGCCTTATTTAAATCATGTAATTCTTTTTCTGGCGGTGAAAAACCAAAAGGA
GGTGATGGGTACTGCTGGAAGGAAGAATTATAAAGAGGTAAACAACGTGGCTAATTTTTT
TTGTC

CDS

1965 bp

>Os06t0649500-01 WD40 repeat-like domain containing protein.
ATGGAGGACGAGGAGATGGAGAAGAAGGTGCAGCAGTACCTGCAGCGGAAGGGGTTCCGC
CTCACCGAGCTCGCGTTGCAGGAGGAGCGCAACCGCATCTCCACCTCCTCCGTCTCCGAC
GTCGCGCTCGCCAGGTCGGAAAATGATCCGGCAAGATACTATGATGGTTATAGTAAACTA
AGAACATGGGCATACAGTTCTCTCGATCAGTACAAGCATGAATTACTCCGTGTCCTTTAC
CCAGTGTTTATCCATTCCTTCATGGATCTAGTGGCAGAGGGACATACACAGGAAGCTCGG
TCCTTTTTCCACACGTTCCATGAAGACCATGAACTGATGCATTCTAGGGATCTCCAGAAA
CTGGAAGGCATTCTTTCTCCTTCACATTTGGAGGAAATGGAACTGGCCAGATCTTTAAGG
AAAAATCAATTCAGAATTAAGTTATGTGAGTATTCATATGAGTTACTCCTCCAGTATCTC
CAGAAAACACAAGCTCTTGTGGTTCTTGGAATAATAAATGAACGCACAACTTTTGACGTA
TCCCCTGGTCAGCCATCTTTAATCTCTGATGACACGGATGTTGTTGCTCTAGTTGGAACA
AAGAAGGATTTGGCAAAACAAATAAATCTGAAGGAGGTGCATTGGGGGTTGCTTGAAGAT
TCAGTTGAAGAGCGCATGGAGAAAACACTTTTAGAATCAGATAAAACTGAAGCAGAAAGC
AAGGATGCAGATGCCGAAGATAACAATAAGAGAAAATCTTCGGAAGGTGGAAAGCAGGGA
GGTTCTGTTAAAAAGGTCAAAAAAGATAAGATTGCAGGAGCCACAGGGAAAACCAATAAA
TCTGAAACAAGCATAGTTTCGGTGGCACCTCGTGTGAAACCAGAGCTTACACTTCCAGTG
ATTCCTGTTGAAGTCGAGCAGTCAATTCTTGAGGATTTGCGAAACCGTGCACAGTTGAAT
AGCCTGGCATTGCCATCTGTTAGCTTCTACACATTCCTTAATACTCATAATGGgctaaat
tgctcatcaatttCACATGACGGCTCTTTGGTTGTGGGTGGATTCTCTGACTCATCAGTG
AAGGTTTGGGATATGTCAAAGATTGGCCAACCGCCGAAAACATCTAGTCCACAAGGAGAG
AATGGACTTTCCCAGGGTGAGCGCACATCAGCATCAGATTATGGAAAAAGACCTTATACA
TTATTCCAAGGTCATTCTGGACCAGTTTATTCCGCTGCATTTAGCCCATTCGGAGATTTT
CTCTTGTCATCATCCTCAGACTCAACAATTCGACTATGGAGTACCAAGTTGAATGCTAAT
CTTGTTTGCTACAAAGGACACAACTACCCTGTTTGGGATGTACAATTTAGCCCAGTTGGT
CATTATTTTGCTAGCGCTTCTCATGACAGGACTGCTAGAATTTGGTCAATGGATAAAATC
CAGCCTTTGCGGATAATGGCTGGACATCTCTCTGATGTTGATTGTGTGCAGTGGCATGTT
AACTGTAACTACATTGCCACCGGCTCTAGTGACAAAACTGTAAGATTATGGGATGTTCAA
ACTGGTGAATGTATACGGATGTTCATTGGCCATAGGAGTATGGTTTTATCATTGGCTATG
TCTCCTGATGGGCGATACATGGCCTCCGGAGATGAAGATGGAACCATCATGATGTGGGAT
CTCTCTTCTGGTCGGTGCGTTTCACCACTTGGGGGACACAGCTCTTGTGTGTGGTCACTT
GCTTACAGTTGTGAAGGGGCATTGCTTGCATCTGGATCAGCCGACTGCACTGTGAAACTC
TGGGATGTTGCCTCCAGCACGAAGGTCCTTAAGACAGATGATACCTCAACTAACCGGCTG
AGGATGCTCAAAACTCTCCGTACAAAATCAACTCCTGTTTATACTCTGCGGTTTTCTCGG
CGAAATCTTTTATTTGCGGCTGGTGCTCTCTCACTTGGCTCCTAA

Protein

655 aa

>Os06t0649500-01 WD40 repeat-like domain containing protein.
MEDEEMEKKVQQYLQRKGFRLTELALQEERNRISTSSVSDVALARSENDPARYYDGYSKL
RTWAYSSLDQYKHELLRVLYPVFIHSFMDLVAEGHTQEARSFFHTFHEDHELMHSRDLQK
LEGILSPSHLEEMELARSLRKNQFRIKLCEYSYELLLQYLQKTQALVVLGIINERTTFDV
SPGQPSLISDDTDVVALVGTKKDLAKQINLKEVHWGLLEDSVEERMEKTLLESDKTEAES
KDADAEDNNKRKSSEGGKQGGSVKKVKKDKIAGATGKTNKSETSIVSVAPRVKPELTLPV
IPVEVEQSILEDLRNRAQLNSLALPSVSFYTFLNTHNGLNCSSISHDGSLVVGGFSDSSV
KVWDMSKIGQPPKTSSPQGENGLSQGERTSASDYGKRPYTLFQGHSGPVYSAAFSPFGDF
LLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDKI
QPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLAM
SPDGRYMASGDEDGTIMMWDLSSGRCVSPLGGHSSCVWSLAYSCEGALLASGSADCTVKL
WDVASSTKVLKTDDTSTNRLRMLKTLRTKSTPVYTLRFSRRNLLFAAGALSLGS*

5'UTR

chr06:26529305..26529397 (+ strand) : 93 bp

CDS

chr06:26529398..26529531 (+ strand) : 134 bp

chr06:26530392..26530473 (+ strand) : 82 bp

chr06:26531001..26531079 (+ strand) : 79 bp

chr06:26531179..26531276 (+ strand) : 98 bp

chr06:26531404..26531460 (+ strand) : 57 bp

chr06:26532044..26532131 (+ strand) : 88 bp

chr06:26532241..26532350 (+ strand) : 110 bp

chr06:26532533..26532634 (+ strand) : 102 bp

chr06:26532889..26533040 (+ strand) : 152 bp

chr06:26533841..26533951 (+ strand) : 111 bp

chr06:26534027..26534094 (+ strand) : 68 bp

chr06:26534185..26534226 (+ strand) : 42 bp

chr06:26534640..26534804 (+ strand) : 165 bp

chr06:26534906..26534982 (+ strand) : 77 bp

chr06:26536302..26536418 (+ strand) : 117 bp

chr06:26536557..26536822 (+ strand) : 266 bp

chr06:26537342..26537437 (+ strand) : 96 bp

chr06:26537521..26537587 (+ strand) : 67 bp

chr06:26537680..26537733 (+ strand) : 54 bp

3'UTR

chr06:26537734..26538020 (+ strand) : 287 bp

FASTA

>Os06t0649500-01 class=Sequence position=chr06:26529305..26538020 (+ strand)
GTCTCGCTGC TCTGAGTCGC GTCGCGTCTC CCTCCCGCGC GACGGATCCG AGAGCCCTAA ACCCTAGAAC TCCCTCGCCC
TCGCGTCGGC GCCATGGAGG ACGAGGAGAT GGAGAAGAAG GTGCAGCAGT ACCTGCAGCG GAAGGGGTTC CGCCTCACCG
AGCTCGCGTT GCAGGAGGAG CGCAACCGCA TCTCCACCTC CTCCGTCTCC GACGTCGCGC TCGCCAGGTA CACCTGCTCG
CCGCCGGGCC CTTTCCAATC TCCTCTCCTC TCCTCCGCCA GCTAGCTGGG CGAGCCCCCC TAACTCTGCC CCGTTGCGAC
TCGGACCTCT CGGATCGAGG AAACCTAGGT AGTGGATTTT GTGCAATTTT GTCCAGCTCG CTTTTGGGCA TCGAGGTGCC
ATATCACACG TGCCCGTGAT TGGGTTGCGG GTGCGAGTTT TTCCGCACGA GGAAATAGTT TGCGGCATTT TTGGAGAGCT
AAAAGTTGCT TGATTGAGGG TTGGGAATTG CTTTGTGGAC GTAGCAATGA GTAACACCAA TTTTGAACGA TGAACTCTCT
ACTGGTAATT CCCATGATGA TAAGGACATT TCAGGGCAGT ATGCAGCTTA TGCTTGATAA TGGGTTAAGT AGTGTCCGTA
GATGGTTCTA ctgcacttat atctagattg tagttaatac ctcaagtgat taaactgatt tttgggtcac taagatgcca
ctttataacc ttttttttcc agattacaat aattaaaact aaattttctt gtcatatact gagaaaactt taatattatg
gaagtatgct ttgttgataa atttagtcat actattttca tatattgaag accagatata ctagagaata tctctgttca
taagtaatgt ggtttgactg tatgtattat gcgacgtcac cttttgtttt gattggagag aGTAATTCTT CCATCTTTTC
TGTCTTTTTT TGTCAGCTTC CAATAGTTGT GGCATCCATT ATTTCACAAT AATTCTGGCT ATGGTTTATT TTTCTTATAA
TCCTACCGAC TAATGCCTTT TGGTTGCATT ATCTTCTGCA ATGATAGGTC GGAAAATGAT CCGGCAAGAT ACTATGATGG
TTATAGTAAA CTAAGAACAT GGGCATACAG TTCTCTCGAT CAGTACAAGG TGTGCTACAC ATACATAGAT TGGACTTCAC
CTTTTGATCT TGCAGTACAT TTTATTGTGC TTCACAATCA AACATCGTTA GCTAAAATTA TGAGTGATTT CTAACTGTCC
ATTTGTTACA TAGTCTTTCT TTAATGAGTG ATTTCATGTT ATTTATGGAT AATTACTTTC ATGTTTGCAT GCTAGCTTCA
GATGGAACAC TTTTAGGATT ATATTGTCAT AAACCAAAGC TTCTAGAATT ATACTTTATT GCCTGCATGC TAACTTCTGA
TGGAGTACTT TCCTAGCAAC TCTTTGTGTT CTCTGCATGC ATTCACAATA TGGGCCATTT TACAAAGCTA AAGTACCtgt
ccagattcat aactaaaatt tgctatattt tgggacagag TACTATATCA TAAACACTGA ATATATTTTT GCCTCCGACG
GACATGTTAA TATTAGATTT CAATTTGTGC ATATTTCTGT TCTTAAATTT GGTTATATGT ATACTATGTT TCTGAATTTT
CATCCCTTTT TTGTAGCATG AATTACTCCG TGTCCTTTAC CCAGTGTTTA TCCATTCCTT CATGGATCTA GTGGCAGAGG
GACATACACA GGAAGGTATT GTTAGTTGGC AGATAGATTA GATAAACCCT CTTTGTCATG TCATGTTTTC TTTTAGTTTA
TTCTGGGCAA TTTCTTTCCT TGCGGGCCCT GCAGCTCGGT CCTTTTTCCA CACGTTCCAT GAAGACCATG AACTGATGCA
TTCTAGGGAT CTCCAGAAAC TGGAAGGCAT TCTTTCTCCT TCACATTTGG AGGTCAACAC TTTTAGTTCT CTTACATTGT
AACATTCTGT TCTTATTGAA GATCTTCATT TATTTATTTG GTTGTATCTT CTCATGATTC ATACACTGCG CTTATCATTC
TGCATGCTGT ATATTTCAGG AAATGGAACT GGCCAGATCT TTAAGGAAAA ATCAATTCAG AATTAAGTTA TGTGAGGTTG
TATCCACATA ATAATTTGCT GTATTTCCAT TTATCTCTTT GAACTTTGAT TCTGAGTTGA CCCTTTTAAT AATTTAACCA
ATTTATGAAG ACAAAACGTT TTGACAGCTT AATATTTGTT GTTTTGATGA TATATCCAGG TGTTTTTGTT TTTTTACCAC
CCTTTTCAAT TTATTGGCTT AGCAATGTTA GAGACCGAGC ACAAAATTGG CACCATTTAG TCAGTTAGTC ATTACTTACT
GTTACTCATT GATCCTGATA GGCAGCTAAT GTCAAATAAA AATATGATTA TTTTGATTTG TATTGACTGG AACTAGTGGA
CCTTTTCTTT TCTTTTCGTT TTTGAACTAT CCTTGTTATA AGGTTACAGC AAGATCAAGT TTAATGTTCT TCCTGAGTTA
AAGTTTTCAC ATTTGATGTT CTTCCACCAT TTGAGATAAA AAAGTTTAAT GACTTTCCTG AGATAAAGCT TTCATATTTT
GTCTCCCAGA TAGCTTTTAT AATTTCAAAT TTCTTGTCTG CTGCAATGTT ATTTAAAAAA AAACACATCT CGTGATCCAA
TTATTGAATT TGGTTGCAGT ATTCATATGA GTTACTCCTC CAGTATCTCC AGAAAACACA AGCTCTTGTG GTTCTTGGAA
TAATAAATGA ACGCACAACT TTTGACGGTA ACATTCCCCA ATATCATTCA GATTAATACC CTAATTTCTG TCATGCATTT
TCTCGTTTAC ACTTCTCTTG TCTACTGTGC CACTTATCCC TGTTCAATAT TGGCAGTATC CCCTGGTCAG CCATCTTTAA
TCTCTGATGA CACGGATGTT GTTGCTCTAG TTGGAACAAA GAAGGATTTG GCAAAACAAA TAAATCTGAA GGAGGTGCAT
TGGGGGGTAT GGTCTGCATC AGTCTTGTTG ACCGCTATTG CCTGTTCTAT CTATTTGTTG ATGATTTGGA TTCAACAGAT
CGAAACAATC CACACCAATC AGTTATTTGA TGGGATTCTA TCATTTTCAT TGAACTTTTA ACTATGCTCA GGCATTTTAT
TTTTGTAAAA TTAAATTCTG GTATGCAGTT GCTTGAAGAT TCAGTTGAAG AGCGCATGGA GAAAACACTT TTAGAATCAG
ATAAAACTGA AGCAGAAAGC AAGGATGCAG ATGCCGAAGA TAACAATAAG GTACTCTTTA TCGTATCGAA GATTTGTTAA
GTTTACTACC TATATCCTCA GCCACTGATA GAAGAGCCAT CTATTTCTTT TTGTTTGGGC CAGGCTATTA GCAGCTTGTT
GTCTTATACT TCCTTAAGCA GTCCATAGAA AATATGCATT GCTTAGCTCC ACTCTGCATG TTCCTGTGCT TCCCAGTTTT
GAGTCCAAAT TGATGTTTCT TAGTATTTTA GCTTCATATT TTTATCTTCT TATTTTTGCT GCAGAGAAAA TCTTCGGAAG
GTGGAAAGCA GGGAGGTTCT GTTAAAAAGG TCAAAAAAGA TAAGATTGCA GGAGCCACAG GGAAAACCAA TAAATCTGAA
ACAAGCATAG TTTCGGTGGC ACCTCGTGTG AAACCAGAGC TTACACTTCC AGTGATGTAC ACTTAAATCC CTTCATATCT
CTCTTAGGAA AAATCTAGTT TGGTCGTTTG ACTTTGATAT CTAGCCTGGT CTCTAACCTA AAGTTTTTAA AATTCTCCAT
CCTGTGGATT TTTCAGGACA TAATAAGTTA TTTTAAATGG ATTCGTCATT CCAACTTAGG ACAATTTTAA TTTTAATTTT
ATTTTCTTTT TTTTTTGCCC GTTGCGTTTT CCTATCTGTG ATATTCTGAT TATGTTTCCC ATTTTTATGC CAGTCCATAT
TAACCATGTT TTGCTTCAAT TCATGCACCT ACTATTCCAT TTGTTTTCTT TATGAATTTC TAATCCAGGA CAAGGCCAGA
ACTTATTCAA AGCTGTCCTG TACATACACT ATGGACCAAC ATATATTGTT CAACACAACA TGCTTCATTA CACATGCTGC
TCAATGTTTG TTCTGCTAGT TTTTTCTCTC TCTAAAATTA CCTGGTTAAG CCAACTCAAA TAGTATGGAA GGTGGAATTG
TATCCACCGG CCAATTTTTA TTCGTTAGAT TGTTGATGAC GATTATGTGG ACCTGACTCT TTGCCAGTTT GCTTAACTGC
AGTACATTTC AACACTTCAA AATTACTTTT TGTAAGACAC TGAACAAAGG CATGTTGCCT TTTTTGCTTT TCAAGAAATC
AACAAAATTG ACCATCCAAT CCTCTTAGTC ATGCAACTTA TTTCTAGGTG GCTCATCTAT CTACATTTTT ATCTGGGAAG
AAGTATTTCA ACCTTGGGTT GTAAGAATCT GAGATATATT TATCCTTTTA TTTCAGTCCT GTTGAAGTCG AGCAGTCAAT
TCTTGAGGAT TTGCGAAACC GTGCACAGTT GAATAGCCTG GCATTGCCAT CTGTTAGCTT CTACACATTC CTTAATACTC
ATAATGGGTA AATTTCTTTG TGGCTTAATA TCtgacactg ccaatttgca tccttttctc tgatcattat ctgtggacat
aggctaaatt gctcatcaat ttCACATGAC GGCTCTTTGG TTGTGGGTGG ATTCTCTGAC TCATCAGTGA AGGCTAGTCC
TTTTTGTCCC TTTTTGGTAC TTTGTTCTTA TATATGTGAT TTCTGTATTA TTTTTGTAAC AATAAAACTT TGTGTTCACC
AGGTTTGGGA TATGTCAAAG ATTGGCCAAC CGCCGAAAAC ATGTTAGTTG TTCTTCACTA CTTAATGTTG TTTGATTCCA
CCTTGTGTTA TGCTGAAATA CTTCCATTAT GTGCTGAAAT GTTTTGATAA TTGCCTTAAG TTTACAGAAC AACATAGTTT
TATTCATTTC ATTTAGTTGA TGTTACAACT TACAAGTACT GAAATATTTT TTCCATATTA ATGCTTGTGT GGATCTGTCA
TTCAAAAATG TCTTCTCGAC CTACCGACAT ATAATGATTT TTTGTCATAC TAGTGCACTA AGTTATGACA TAGCAGTATA
CTTGATTCCA TAACCTGTTC AGGAATCAGG ACTCTTGAAT AGTCTTAGCA TGTCAATTAT CCTAAGTCCT AACATGAGAG
TGTTTTGTTT TATATAATGG TGGTATTTGC TGATTGAAGA AACTTTAATT TTCAGCTAGT CCACAAGGAG AGAATGGACT
TTCCCAGGGT GAGCGCACAT CAGCATCAGA TTATGGAAAA AGACCTTATA CATTATTCCA AGGTCATTCT GGACCAGTTT
ATTCCGCTGC ATTTAGCCCA TTCGGAGATT TTCTCTTGTC ATCATCCTCA GACTCAACAA GTAAAACATC CTTACATTTT
GCTTATTTTC ATATAGTTTG TTTTCCTTTT CGTTTTTCAA CTGAACATAT CGTTTTCATA TATATTTTTT ATTCCTTACA
GTTCGACTAT GGAGTACCAA GTTGAATGCT AATCTTGTTT GCTACAAAGG ACACAACTAC CCTGTTTGGG ATGTACAAGT
ATGTGATTAA CCTTTTTTTT TTGTGTCACA TGTGCAAGTG CAACATATCT GTGGTGCTTT TACTTTCATG AACTGTTTAA
ACGCCTTGTG TTTGTATTGA AAAGAAAAAT GATTGTGTGA TTCGCATAAC TTAAATCAGA ATTGAGCTGA TCTATGGAAG
CTAGTGTACT GATCTCTTAG GCATTACAAC CAGTTTTTGA ATTACTGGTT GCAGCTTTTG AGACAGACTA TGTACAACTA
TTCTGAGCTT CAAACACAGA TCATGTCATA AAATAAGCTT TTGCCATTTG AGTCTGTTGT TTCATCTTGG TATGTTGGCC
ATTGCTGTTA AATAATGAGA CCTTATTAAG GATCCCACTG CCTTCAGTTT TCAATATGTA AATAAAAAAT TAGGTGGCAA
TGGATGCCTC CAGATTATAT TGTTCAATCA ATATGCATTG CCTGCTATTG CATCAGTGCT TATTTTGGTG CATGAGGTGT
GAATATATta catgaacttg cgaggtggtt gcattataat acacaaactt gtaaaacatt cgttccggtg cacaaacttg
aggtttgtgt gaaccaaggt caaaagggca aaatatggct aatcttgctg agttgagtgt tgattaggat gccatgtaag
catgcatgtt aggactatgc catatacata tgcatgtact gagtaaaaca tagaacaaga catactgatt gaacaaagaa
agacatatag caaaccgata aaggatgcaa gggatacaaa ggaaggacaa agtggaaacc aagtacaagg ttatttgcaa
atataacatg tatcatgccc tcctcacatg tgcacgccat gtcctaatga gcatccaact tggtaataag ttgccatgcc
cttttggcct tggttcacac gcaccagaca agttcatgca ccaaaatgaa cgtttaataa gtttatgtGC CCTCCTcaca
tgtgcacgcc atgtcctaat gagcatccaa cttggtaata agttgccatg cccttttggc cttggttcac acgcaccaga
caagttcatg caccaaaatg aacgtttaat aagtttatgt gctgcacccc cttgacaggt tcgtgtaccC CCTTGTGCTC
TCCCTTTTTG TAATGTATCC CTAGCCAGTT TTTCATTTTC AATGTTCTGC ATGATGGAGT AGTTTTATGG GGTTATGCAC
CCTGTTAAAA AGCTTATGAT CAATTTTTAC TGTCCCAACT GCCAAGTTTT CTGATTCTGT TGTTGTAAAC ATTGTGCTAT
GATACATGTT GATACATTTG CTTTTTTCTT TTGTCAGTTT AGCCCAGTTG GTCATTATTT TGCTAGCGCT TCTCATGACA
GGACTGCTAG AATTTGGTCA ATGGATAAAA TCCAGCCTTT GCGGATAATG GCTGGACATC TCTCTGATGT TGATGTAAGT
GTATTTCTGG TTCAAATCAT TTGCTTATAT TGGAGCACTT GATGCTGGAT AGATGCTTAT TCTTTAATGC TTTGTGCTGA
TGCCTGCATA TTCTTACTGA GCTTTATCTA CTACATAATA TTTGGCTGAC AGTGTGTGCA GTGGCATGTT AACTGTAACT
ACATTGCCAC CGGCTCTAGT GACAAAACTG TAAGATTATG GGATGTTCAA ACTGGTGAAT GTATACGGAT GTTCATTGGC
CATAGGAGTA TGGTTTTATC ATTGGCTATG TCTCCTGATG GGCGATACAT GGCCTCCGGA GATGAAGATG GAACCATCAT
GATGTGGGAT CTCTCTTCTG GTCGGTGCGT TTCACCACTT GGGGGACACA GCTCTTGTGT GTGGTCACTT GCTTACAGGT
AATCATTGTT TGTTGCTGCG GGTAAATAAT AGCTTTAATC CACATTGTTT ACATATAAGA ATCGGCTTAA CCGATTCTTT
TATCCTTGTT GAGAGAAATT TGAAGGGCTA TCTTGTGAGA CCTTTTGACA GTGACAGTTT GTTATCCCCT TGAATATCTG
GTTTGAATTT TTATTCTTGA AAAAAACTAA GAATATCAGT ACATATTTCA GAGAGTTATT GCATAGGCAT GTCAACCTTG
CAGCCCACTC AGTTGTTGGT TTCAATTAGT TTCTTATGAA ACCTATTGTT TGAATGAGCC TGTAAATGTG TATTATGCCT
TGCTTCCTAA GCTACTTAAG GGCTGCATTT TGATGCCGCC TTTATTCGGA GGACGCTTTC CATAAATGGT GTATACACAT
TCCTGGACTC TGTTTATGTA TGTTCATTTG TTATTCCTTT CAGCGAGAAG TTATAATATG CTGTCCTGTG ATGTCATGCA
GAGCTCTCTT ATTTAACTTG TTCTGCCACT GTTGTAGTTG TGAAGGGGCA TTGCTTGCAT CTGGATCAGC CGACTGCACT
GTGAAACTCT GGGATGTTGC CTCCAGCACG AAGGTCCTTA AGACAGATGA TACGTGAGTT AGTTTTGAAC TGCTCATAAA
GATGCTTTAT ACATATAAAT CATTGCCTTA CTCTTGTTTG TAAAATATAC TTACAGCTCA ACTAACCGGC TGAGGATGCT
CAAAACTCTC CGTACAAAAT CAACTCCTGT TTATACTCTG CGGGTGAGAA TCTCTCGGTC CATGCATTAT GTTGCATAAG
TTAAGGCTGT TATACTGTAT GCAATTTAAA TGAAACTGCT TTCTTGATGT TGTAGTTTTC TCGGCGAAAT CTTTTATTTG
CGGCTGGTGC TCTCTCACTT GGCTCCTAAG CTTCTGTATG TTCTGTAGAA TACAACTACC AAACATTCTT TCAGTTTTAT
CTCAAGTGAA GTTAGTGCCT AGTGAGTAGT GAGCCTGCTT TTAAGGTTAA TCTGTAGCAC GCGCGTATTG TAATTCGTTC
CAATGTTTGT TGTCTTGTGA CTTTGTAAGT TGTAACAATC GCCTTATTTA AATCATGTAA TTCTTTTTCT GGCGGTGAAA
AACCAAAAGG AGGTGATGGG TACTGCTGGA AGGAAGAATT ATAAAGAGGT AAACAACGTG GCTAATTTTT TTTGTC