Os06t0649500-02

Locus

Os06g0649500

Description

TFIID subunit, WD40-associated region domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-132

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK288906 (DDBJ, Best hit)

Protein Evidence

NP_001058217.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

TFIID subunit, WD40-associated region (IPR007582)

Full-length cDNA

J090081A21 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0649500-02)

Others

Oryzabase (10813)

Transcript

5405 bp

>Os06t0649500-02 TFIID subunit, WD40-associated region domain containing protein.
GAGAGCCCTAAACCCTAGAACTCCCTCGCCCTCGCGTCGGCGCCATGGAGGACGAGGAGA
TGGAGAAGAAGGTGCAGCAGTACCTGCAGCGGAAGGGGTTCCGCCTCACCGAGCTCGCGT
TGCAGGAGGAGCGCAACCGCATCTCCACCTCCTCCGTCTCCGACGTCGCGCTCGCCAGGT
ACACCTGCTCGCCGCCGGGCCCTTTCCAATCTCCTCTCCTCTCCTCCGCCAGCTAGCTGG
GCGAGCCCCCCTAACTCTGCCCCGTTGCGACTCGGACCTCTCGGATCGAGGAAACCTAGG
TAGTGGATTTTGTGCAATTTTGTCCAGCTCGCTTTTGGGCATCGAGGTGCCATATCACAC
GTGCCCGTGATTGGGTTGCGGGTGCGAGTTTTTCCGCACGAGGAAATAGTTTGCGGCATT
TTTGGAGAGCTAAAAGTTGCTTGATTGAGGGTTGGGAATTGCTTTGTGGACGTAGCAATG
AGTAACACCAATTTTGAACGATGAACTCTCTACTGGTAATTCCCATGATGATAAGGACAT
TTCAGGGCAGTATGCAGCTTATGCTTGATAATGGGTTAAGTAGTGTCCGTAGATGGTTCT
Actgcacttatatctagattgtagttaatacctcaagtgattaaactgatttttgggtca
ctaagatgccactttataaccttttttttccagattacaataattaaaactaaattttct
tgtcatatactgagaaaactttaatattatggaagtatgctttgttgataaatttagtca
tactattttcatatattgaagaccagatatactagagaatatctctgttcataagtaatg
tggtttgactgtatgtattatgcgacgtcaccttttgttttgattggagagaGTAATTCT
TCCATCTTTTCTGTCTTTTTTTGTCAGCTTCCAATAGTTGTGGCATCCATTATTTCACAA
TAATTCTGGCTATGGTTTATTTTTCTTATAATCCTACCGACTAATGCCTTTTGGTTGCAT
TATCTTCTGCAATGATAGGTCGGAAAATGATCCGGCAAGATACTATGATGGTTATAGTAA
ACTAAGAACATGGGCATACAGTTCTCTCGATCAGTACAAGGTGTGCTACACATACATAGA
TTGGACTTCACCTTTTGATCTTGCAGTACATTTTATTGTGCTTCACAATCAAACATCGTT
AGCTAAAATTATGAGTGATTTCTAACTGTCCATTTGTTACATAGTCTTTCTTTAATGAGT
GATTTCATGTTATTTATGGATAATTACTTTCATGTTTGCATGCTAGCTTCAGATGGAACA
CTTTTAGGATTATATTGTCATAAACCAAAGCTTCTAGAATTATACTTTATTGCCTGCATG
CTAACTTCTGATGGAGTACTTTCCTAGCAACTCTTTGTGTTCTCTGCATGCATTCACAAT
ATGGGCCATTTTACAAAGCTAAAGTACCtgtccagattcataactaaaatttgctatatt
ttgggacagagTACTATATCATAAACACTGAATATATTTTTGCCTCCGACGGACATGTTA
ATATTAGATTTCAATTTGTGCATATTTCTGTTCTTAAATTTGGTTATATGTATACTATGT
TTCTGAATTTTCATCCCTTTTTTGTAGCATGAATTACTCCGTGTCCTTTACCCAGTGTTT
ATCCATTCCTTCATGGATCTAGTGGCAGAGGGACATACACAGGAAGGTATTGTTAGTTGG
CAGATAGATTAGATAAACCCTCTTTGTCATGTCATGTTTTCTTTTAGTTTATTCTGGGCA
ATTTCTTTCCTTGCGGGCCCTGCAGCTCGGTCCTTTTTCCACACGTTCCATGAAGACCAT
GAACTGATGCATTCTAGGGATCTCCAGAAACTGGAAGGCATTCTTTCTCCTTCACATTTG
GAGGTCAACACTTTTAGTTCTCTTACATTGTAACATTCTGTTCTTATTGAAGATCTTCAT
TTATTTATTTGGTTGTATCTTCTCATGATTCATACACTGCGCTTATCATTCTGCATGCTG
TATATTTCAGGAAATGGAACTGGCCAGATCTTTAAGGAAAAATCAATTCAGAATTAAGTT
ATGTGAGGTTGTATCCACATAATAATTTGCTGTATTTCCATTTATCTCTTTGAACTTTGA
TTCTGAGTTGACCCTTTTAATAATTTAACCAATTTATGAAGACAAAACGTTTTGACAGCT
TAATATTTGTTGTTTTGATGATATATCCAGGTGTTTTTGTTTTTTTACCACCCTTTTCAA
TTTATTGGCTTAGCAATGTTAGAGACCGAGCACAAAATTGGCACCATTTAGTCAGTTAGT
CATTACTTACTGTTACTCATTGATCCTGATAGGCAGCTAATGTCAAATAAAAATATGATT
ATTTTGATTTGTATTGACTGGAACTAGTGGACCTTTTCTTTTCTTTTCGTTTTTGAACTA
TCCTTGTTATAAGGTTACAGCAAGATCAAGTTTAATGTTCTTCCTGAGTTAAAGTTTTCA
CATTTGATGTTCTTCCACCATTTGAGATAAAAAAGTTTAATGACTTTCCTGAGATAAAGC
TTTCATATTTTGTCTCCCAGATAGCTTTTATAATTTCAAATTTCTTGTCTGCTGCAATGT
TATTTAAAAAAAAACACATCTCGTGATCCAATTATTGAATTTGGTTGCAGTATTCATATG
AGTTACTCCTCCAGTATCTCCAGAAAACACAAGCTCTTGTGGTTCTTGGAATAATAAATG
AACGCACAACTTTTGACGGTAACATTCCCCAATATCATTCAGATTAATACCCTAATTTCT
GTCATGCATTTTCTCGTTTACACTTCTCTTGTCTACTGTGCCACTTATCCCTGTTCAATA
TTGGCAGTATCCCCTGGTCAGCCATCTTTAATCTCTGATGACACGGATGTTGTTGCTCTA
GTTGGAACAAAGAAGGATTTGGCAAAACAAATAAATCTGAAGGAGGTGCATTGGGGGGTA
TGGTCTGCATCAGTCTTGTTGACCGCTATTGCCTGTTCTATCTATTTGTTGATGATTTGG
ATTCAACAGATCGAAACAATCCACACCAATCAGTTATTTGATGGGATTCTATCATTTTCA
TTGAACTTTTAACTATGCTCAGGCATTTTATTTTTGTAAAATTAAATTCTGGTATGCAGT
TGCTTGAAGATTCAGTTGAAGAGCGCATGGAGAAAACACTTTTAGAATCAGATAAAACTG
AAGCAGAAAGCAAGGATGCAGATGCCGAAGATAACAATAAGGTACTCTTTATCGTATCGA
AGATTTGTTAAGTTTACTACCTATATCCTCAGCCACTGATAGAAGAGCCATCTATTTCTT
TTTGTTTGGGCCAGGCTATTAGCAGCTTGTTGTCTTATACTTCCTTAAGCAGTCCATAGA
AAATATGCATTGCTTAGCTCCACTCTGCATGTTCCTGTGCTTCCCAGTTTTGAGTCCAAA
TTGATGTTTCTTAGTATTTTAGCTTCATATTTTTATCTTCTTATTTTTGCTGCAGAGAAA
ATCTTCGGAAGGTGGAAAGCAGGGAGGTTCTGTTAAAAAGGTCAAAAAAGATAAGATTGC
AGGAGCCACAGGGAAAACCAATAAATCTGAAACAAGCATAGTTTCGGTGGCACCTCGTGT
GAAACCAGAGCTTACACTTCCAGTGATGTACACTTAAATCCCTTCATATCTCTCTTAGGA
AAAATCTAGTTTGGTCGTTTGACTTTGATATCTAGCCTGGTCTCTAACCTAAAGTTTTTA
AAATTCTCCATCCTGTGGATTTTTCAGGACATAATAAGTTATTTTAAATGGATTCGTCAT
TCCAACTTAGGACAATTTTAATTTTAATTTTATTTTCTTTTTTTTTTGCCCGTTGCGTTT
TCCTATCTGTGATATTCTGATTATGTTTCCCATTTTTATGCCAGTCCATATTAACCATGT
TTTGCTTCAATTCATGCACCTACTATTCCATTTGTTTTCTTTATGAATTTCTAATCCAGG
ACAAGGCCAGAACTTATTCAAAGCTGTCCTGTACATACACTATGGACCAACATATATTGT
TCAACACAACATGCTTCATTACACATGCTGCTCAATGTTTGTTCTGCTAGTTTTTTCTCT
CTCTAAAATTACCTGGTTAAGCCAACTCAAATAGTATGGAAGGTGGAATTGTATCCACCG
GCCAATTTTTATTCGTTAGATTGTTGATGACGATTATGTGGACCTGACTCTTTGCCAGTT
TGCTTAACTGCAGTACATTTCAACACTTCAAAATTACTTTTTGTAAGACACTGAACAAAG
GCATGTTGCCTTTTTTGCTTTTCAAGAAATCAACAAAATTGACCATCCAATCCTCTTAGT
CATGCAACTTATTTCTAGGTGGCTCATCTATCTACATTTTTATCTGGGAAGAAGTATTTC
AACCTTGGGTTGTAAGAATCTGAGATATATTTATCCTTTTATTTCAGTCCTGTTGAAGTC
GAGCAGTCAATTCTTGAGGATTTGCGAAACCGTGCACAGTTGAATAGCCTGGCATTGCCA
TCTGTTAGCTTCTACACATTCCTTAATACTCATAATGGGTAAATTTCTTTGTGGCTTAAT
ATCtgacactgccaatttgcatccttttctctgatcattatctgtggacataggctaaat
tgctcatcaatttCACATGACGGCTCTTTGGTTGTGGGTGGATTCTCTGACTCATCAGTG
AAGGCTAGTCCTTTTTGTCCCTTTTTGGTACTTTGTTCTTATATATGTGATTTCTGTATT
ATTTTTGTAACAATAAAACTTTGTGTTCACCAGGTTTGGGATATGTCAAAGATTGGCCAA
CCGCCGAAAACATGTTAGTTGTTCTTCACTACTTAATGTTGTTTGATTCCACCTTGTGTT
ATGCTGAAATACTTCCATTATGTGCTGAAATGTTTTGATAATTGCCTTAAGTTTACAGAA
CAACATAGTTTTATTCATTTCATTTAGTTGATGTTACAACTTACAAGTACTGAAATATTT
TTTCCATATTAATGCTTGTGTGGATCTGTCATTCAAAAATGTCTTCTCGACCTACCGACA
TATAATGATTTTTTGTCATACTAGTGCACTAAGTTATGACATAGCAGTATACTTGATTCC
ATAACCTGTTCAGGAATCAGGACTCTTGAATAGTCTTAGCATGTCAATTATCCTAAGTCC
TAACATGAGAGTGTTTTGTTTTATATAATGGTGGTATTTGCTGATTGAAGAAACTTTAAT
TTTCAGCTAGTCCACAAGGAGAGAATGGACTTTCCCAGGGTGAGCGCACATCAGCATCAG
ATTATGGAAAAAGACCTTATACATTATTCCAAGGTCATTCTGGACCAGTTTATTCCGCTG
CATTT

CDS

222 bp

>Os06t0649500-02 TFIID subunit, WD40-associated region domain containing protein.
ATGCCTTTTGGTTGCATTATCTTCTGCAATGATAGGTCGGAAAATGATCCGGCAAGATAC
TATGATGGTTATAGTAAACTAAGAACATGGGCATACAGTTCTCTCGATCAGTACAAGGTG
TGCTACACATACATAGATTGGACTTCACCTTTTGATCTTGCAGTACATTTTATTGTGCTT
CACAATCAAACATCGTTAGCTAAAATTATGAGTGATTTCTAA

Protein

74 aa

>Os06t0649500-02 TFIID subunit, WD40-associated region domain containing protein.
MPFGCIIFCNDRSENDPARYYDGYSKLRTWAYSSLDQYKVCYTYIDWTSPFDLAVHFIVL
HNQTSLAKIMSDF*

5'UTR

chr06:26529354..26530356 (+ strand) : 1003 bp

CDS

chr06:26530357..26530578 (+ strand) : 222 bp

3'UTR

chr06:26530579..26534758 (+ strand) : 4180 bp

FASTA

>Os06t0649500-02 class=Sequence position=chr06:26529354..26534758 (+ strand)
GAGAGCCCTA AACCCTAGAA CTCCCTCGCC CTCGCGTCGG CGCCATGGAG GACGAGGAGA TGGAGAAGAA GGTGCAGCAG
TACCTGCAGC GGAAGGGGTT CCGCCTCACC GAGCTCGCGT TGCAGGAGGA GCGCAACCGC ATCTCCACCT CCTCCGTCTC
CGACGTCGCG CTCGCCAGGT ACACCTGCTC GCCGCCGGGC CCTTTCCAAT CTCCTCTCCT CTCCTCCGCC AGCTAGCTGG
GCGAGCCCCC CTAACTCTGC CCCGTTGCGA CTCGGACCTC TCGGATCGAG GAAACCTAGG TAGTGGATTT TGTGCAATTT
TGTCCAGCTC GCTTTTGGGC ATCGAGGTGC CATATCACAC GTGCCCGTGA TTGGGTTGCG GGTGCGAGTT TTTCCGCACG
AGGAAATAGT TTGCGGCATT TTTGGAGAGC TAAAAGTTGC TTGATTGAGG GTTGGGAATT GCTTTGTGGA CGTAGCAATG
AGTAACACCA ATTTTGAACG ATGAACTCTC TACTGGTAAT TCCCATGATG ATAAGGACAT TTCAGGGCAG TATGCAGCTT
ATGCTTGATA ATGGGTTAAG TAGTGTCCGT AGATGGTTCT Actgcactta tatctagatt gtagttaata cctcaagtga
ttaaactgat ttttgggtca ctaagatgcc actttataac cttttttttc cagattacaa taattaaaac taaattttct
tgtcatatac tgagaaaact ttaatattat ggaagtatgc tttgttgata aatttagtca tactattttc atatattgaa
gaccagatat actagagaat atctctgttc ataagtaatg tggtttgact gtatgtatta tgcgacgtca ccttttgttt
tgattggaga gaGTAATTCT TCCATCTTTT CTGTCTTTTT TTGTCAGCTT CCAATAGTTG TGGCATCCAT TATTTCACAA
TAATTCTGGC TATGGTTTAT TTTTCTTATA ATCCTACCGA CTAATGCCTT TTGGTTGCAT TATCTTCTGC AATGATAGGT
CGGAAAATGA TCCGGCAAGA TACTATGATG GTTATAGTAA ACTAAGAACA TGGGCATACA GTTCTCTCGA TCAGTACAAG
GTGTGCTACA CATACATAGA TTGGACTTCA CCTTTTGATC TTGCAGTACA TTTTATTGTG CTTCACAATC AAACATCGTT
AGCTAAAATT ATGAGTGATT TCTAACTGTC CATTTGTTAC ATAGTCTTTC TTTAATGAGT GATTTCATGT TATTTATGGA
TAATTACTTT CATGTTTGCA TGCTAGCTTC AGATGGAACA CTTTTAGGAT TATATTGTCA TAAACCAAAG CTTCTAGAAT
TATACTTTAT TGCCTGCATG CTAACTTCTG ATGGAGTACT TTCCTAGCAA CTCTTTGTGT TCTCTGCATG CATTCACAAT
ATGGGCCATT TTACAAAGCT AAAGTACCtg tccagattca taactaaaat ttgctatatt ttgggacaga gTACTATATC
ATAAACACTG AATATATTTT TGCCTCCGAC GGACATGTTA ATATTAGATT TCAATTTGTG CATATTTCTG TTCTTAAATT
TGGTTATATG TATACTATGT TTCTGAATTT TCATCCCTTT TTTGTAGCAT GAATTACTCC GTGTCCTTTA CCCAGTGTTT
ATCCATTCCT TCATGGATCT AGTGGCAGAG GGACATACAC AGGAAGGTAT TGTTAGTTGG CAGATAGATT AGATAAACCC
TCTTTGTCAT GTCATGTTTT CTTTTAGTTT ATTCTGGGCA ATTTCTTTCC TTGCGGGCCC TGCAGCTCGG TCCTTTTTCC
ACACGTTCCA TGAAGACCAT GAACTGATGC ATTCTAGGGA TCTCCAGAAA CTGGAAGGCA TTCTTTCTCC TTCACATTTG
GAGGTCAACA CTTTTAGTTC TCTTACATTG TAACATTCTG TTCTTATTGA AGATCTTCAT TTATTTATTT GGTTGTATCT
TCTCATGATT CATACACTGC GCTTATCATT CTGCATGCTG TATATTTCAG GAAATGGAAC TGGCCAGATC TTTAAGGAAA
AATCAATTCA GAATTAAGTT ATGTGAGGTT GTATCCACAT AATAATTTGC TGTATTTCCA TTTATCTCTT TGAACTTTGA
TTCTGAGTTG ACCCTTTTAA TAATTTAACC AATTTATGAA GACAAAACGT TTTGACAGCT TAATATTTGT TGTTTTGATG
ATATATCCAG GTGTTTTTGT TTTTTTACCA CCCTTTTCAA TTTATTGGCT TAGCAATGTT AGAGACCGAG CACAAAATTG
GCACCATTTA GTCAGTTAGT CATTACTTAC TGTTACTCAT TGATCCTGAT AGGCAGCTAA TGTCAAATAA AAATATGATT
ATTTTGATTT GTATTGACTG GAACTAGTGG ACCTTTTCTT TTCTTTTCGT TTTTGAACTA TCCTTGTTAT AAGGTTACAG
CAAGATCAAG TTTAATGTTC TTCCTGAGTT AAAGTTTTCA CATTTGATGT TCTTCCACCA TTTGAGATAA AAAAGTTTAA
TGACTTTCCT GAGATAAAGC TTTCATATTT TGTCTCCCAG ATAGCTTTTA TAATTTCAAA TTTCTTGTCT GCTGCAATGT
TATTTAAAAA AAAACACATC TCGTGATCCA ATTATTGAAT TTGGTTGCAG TATTCATATG AGTTACTCCT CCAGTATCTC
CAGAAAACAC AAGCTCTTGT GGTTCTTGGA ATAATAAATG AACGCACAAC TTTTGACGGT AACATTCCCC AATATCATTC
AGATTAATAC CCTAATTTCT GTCATGCATT TTCTCGTTTA CACTTCTCTT GTCTACTGTG CCACTTATCC CTGTTCAATA
TTGGCAGTAT CCCCTGGTCA GCCATCTTTA ATCTCTGATG ACACGGATGT TGTTGCTCTA GTTGGAACAA AGAAGGATTT
GGCAAAACAA ATAAATCTGA AGGAGGTGCA TTGGGGGGTA TGGTCTGCAT CAGTCTTGTT GACCGCTATT GCCTGTTCTA
TCTATTTGTT GATGATTTGG ATTCAACAGA TCGAAACAAT CCACACCAAT CAGTTATTTG ATGGGATTCT ATCATTTTCA
TTGAACTTTT AACTATGCTC AGGCATTTTA TTTTTGTAAA ATTAAATTCT GGTATGCAGT TGCTTGAAGA TTCAGTTGAA
GAGCGCATGG AGAAAACACT TTTAGAATCA GATAAAACTG AAGCAGAAAG CAAGGATGCA GATGCCGAAG ATAACAATAA
GGTACTCTTT ATCGTATCGA AGATTTGTTA AGTTTACTAC CTATATCCTC AGCCACTGAT AGAAGAGCCA TCTATTTCTT
TTTGTTTGGG CCAGGCTATT AGCAGCTTGT TGTCTTATAC TTCCTTAAGC AGTCCATAGA AAATATGCAT TGCTTAGCTC
CACTCTGCAT GTTCCTGTGC TTCCCAGTTT TGAGTCCAAA TTGATGTTTC TTAGTATTTT AGCTTCATAT TTTTATCTTC
TTATTTTTGC TGCAGAGAAA ATCTTCGGAA GGTGGAAAGC AGGGAGGTTC TGTTAAAAAG GTCAAAAAAG ATAAGATTGC
AGGAGCCACA GGGAAAACCA ATAAATCTGA AACAAGCATA GTTTCGGTGG CACCTCGTGT GAAACCAGAG CTTACACTTC
CAGTGATGTA CACTTAAATC CCTTCATATC TCTCTTAGGA AAAATCTAGT TTGGTCGTTT GACTTTGATA TCTAGCCTGG
TCTCTAACCT AAAGTTTTTA AAATTCTCCA TCCTGTGGAT TTTTCAGGAC ATAATAAGTT ATTTTAAATG GATTCGTCAT
TCCAACTTAG GACAATTTTA ATTTTAATTT TATTTTCTTT TTTTTTTGCC CGTTGCGTTT TCCTATCTGT GATATTCTGA
TTATGTTTCC CATTTTTATG CCAGTCCATA TTAACCATGT TTTGCTTCAA TTCATGCACC TACTATTCCA TTTGTTTTCT
TTATGAATTT CTAATCCAGG ACAAGGCCAG AACTTATTCA AAGCTGTCCT GTACATACAC TATGGACCAA CATATATTGT
TCAACACAAC ATGCTTCATT ACACATGCTG CTCAATGTTT GTTCTGCTAG TTTTTTCTCT CTCTAAAATT ACCTGGTTAA
GCCAACTCAA ATAGTATGGA AGGTGGAATT GTATCCACCG GCCAATTTTT ATTCGTTAGA TTGTTGATGA CGATTATGTG
GACCTGACTC TTTGCCAGTT TGCTTAACTG CAGTACATTT CAACACTTCA AAATTACTTT TTGTAAGACA CTGAACAAAG
GCATGTTGCC TTTTTTGCTT TTCAAGAAAT CAACAAAATT GACCATCCAA TCCTCTTAGT CATGCAACTT ATTTCTAGGT
GGCTCATCTA TCTACATTTT TATCTGGGAA GAAGTATTTC AACCTTGGGT TGTAAGAATC TGAGATATAT TTATCCTTTT
ATTTCAGTCC TGTTGAAGTC GAGCAGTCAA TTCTTGAGGA TTTGCGAAAC CGTGCACAGT TGAATAGCCT GGCATTGCCA
TCTGTTAGCT TCTACACATT CCTTAATACT CATAATGGGT AAATTTCTTT GTGGCTTAAT ATCtgacact gccaatttgc
atccttttct ctgatcatta tctgtggaca taggctaaat tgctcatcaa tttCACATGA CGGCTCTTTG GTTGTGGGTG
GATTCTCTGA CTCATCAGTG AAGGCTAGTC CTTTTTGTCC CTTTTTGGTA CTTTGTTCTT ATATATGTGA TTTCTGTATT
ATTTTTGTAA CAATAAAACT TTGTGTTCAC CAGGTTTGGG ATATGTCAAA GATTGGCCAA CCGCCGAAAA CATGTTAGTT
GTTCTTCACT ACTTAATGTT GTTTGATTCC ACCTTGTGTT ATGCTGAAAT ACTTCCATTA TGTGCTGAAA TGTTTTGATA
ATTGCCTTAA GTTTACAGAA CAACATAGTT TTATTCATTT CATTTAGTTG ATGTTACAAC TTACAAGTAC TGAAATATTT
TTTCCATATT AATGCTTGTG TGGATCTGTC ATTCAAAAAT GTCTTCTCGA CCTACCGACA TATAATGATT TTTTGTCATA
CTAGTGCACT AAGTTATGAC ATAGCAGTAT ACTTGATTCC ATAACCTGTT CAGGAATCAG GACTCTTGAA TAGTCTTAGC
ATGTCAATTA TCCTAAGTCC TAACATGAGA GTGTTTTGTT TTATATAATG GTGGTATTTG CTGATTGAAG AAACTTTAAT
TTTCAGCTAG TCCACAAGGA GAGAATGGAC TTTCCCAGGG TGAGCGCACA TCAGCATCAG ATTATGGAAA AAGACCTTAT
ACATTATTCC AAGGTCATTC TGGACCAGTT TATTCCGCTG CATTT