Os06t0650300-01

Locus

Os06g0650300

Description

Histone H4 acetyltransferase, Regulation of grain weight, yield, and plant biomass

RAP-DB Gene Symbol Synonym(s)

OsglHAT1, GW6a

RAP-DB Gene Name Synonym(s)

GCN5-related N-acetyltransferase-like histone acetyltransferase 1, GNAT-like HAT1, Grain weight on chromosome 6-a

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsglHAT1, glHAT1, GW6a

Oryzabase Gene Name Synonym(s)

GCN5-related N-acetyltransferase-like histone acetyltransferase 1, GNAT-like HAT1, Grain weight on chromosome 6-a

Transcript Evidence

LC003015

Protein Evidence

Q67UR2

Literature

PMID: 25535376

Note

Manual Curation

January 5, 2015

Gene Ontology (GO)

Molecular Function: N-acetyltransferase activity (GO:0008080)

Functional domain (InterPro)

Acyl-CoA N-acyltransferase (IPR016181)

GNAT domain (IPR000182)

Expression Databases

TENOR (Os06t0650300-00)

Others

Oryzabase (18480)

Transcript

1260 bp

>Os06t0650300-01 Histone H4 acetyltransferase, Regulation of grain weight, yield, and plant biomass
ATGGTGGAGACGACGACGATGATGAAGGTGTTGGTGAGGGTGAGGGAGTTCGACGTGGAG
AAGGACTTGCCGGCGGTGGAGGAGCTGGAGCGGCGGTGCCAGGTCGGCCTGTCCGGCGAC
ATGGCCGCGGTTCACGACCACGCCGACGACGGCGACGGCGCCGCCGCCAAGGAGAAGAAG
AAGACCAAGACGAAGACGAAGAAGAAGAAGGCGAGCATGTCTCTCTGCGTCGAGCAGATC
GGCGACCCGCTCGCCAGAGTCCGCCACGCCCCGGAACACGTCATGCTGGTGGCGGAGTAC
GGCGAGGAGGAGGAGAAGAAGAAGGTGGTGGGTGTGATCAAGGCGTGCGTGAAGACGGTG
AGCCGTGGCGGGAAGCAGGAGAAGCCATTCGTGAAGGTCGCCAACCTCCTCGGCCTCAGG
GTGTCGCCATCTCACAGGCGGCTGGGGATCGGGACGGCGCTGGTGAGGCGGGCGGAGGAG
TGGTGCGTGGCGAGGGGAGCGGAGCACGCGACGATGGCGACGACGGAGTCGAACGCGGCG
TCGCTGGCGCTGTTCACGGGGAGGTTCGGGTACGCGCCGTTCAGGCGGCCGGAGTTCATC
GGCCACCCGGTGCACGCGCACCGGCTGCCGGTGGCGAGGGGGCACCGCGTGTTCCAGCTG
CCCCCCGAGGTCGCCGCGGCGGCGTACGCGCGGCTGCTCCCGCCGCAGGACGCCGAGTTC
CTCCCCGCCGACATGCCCGCGCTGCTCGCACACAAGCTCACCCTCGGCACCTTCGTCGCC
GTCGCCGCTGACGGCGCGTCGTTCGCCGTGCTCAGCGTCTGGGACTCCACACGCTCGCTC
AGCCTCCGCGTGAGCGGCGCCCCGGCGCTGCTCCGCGCGTCGCTCGCCGCGCTCCGGGCG
CTCGACCGCGGTGCGCCGTGGCTGCACCTCCCCTCCATCCCGGACATCTTCCGCCCCTTC
GGCGCCTACCTCCTCTACGGCCTCCGCATGTCCGGCCCGGACGGCCCGGCGCTGCTCCGG
TCGCTCTGCCACCACGCCCACAACGTCGCCCGCAAGAACCCGGCGTGCGCCGTCGTCGCC
GCCGACATCTCCCCCGACGACCCGGCCGCCGCCGCCGTCCCGCGGTGGCGCCGCTTCTGC
TGCGACGAGGACGTCTGGTGCATCAAGAACCTCAACCCGGACGAACACGACGCCGACGAC
TGGGCGGCGCCGCCGCCGCCGCCGGGACGCCACCTCTTCGTCGACCCCCGCGAGTTCTAA

CDS

1260 bp

>Os06t0650300-01 Histone H4 acetyltransferase, Regulation of grain weight, yield, and plant biomass
ATGGTGGAGACGACGACGATGATGAAGGTGTTGGTGAGGGTGAGGGAGTTCGACGTGGAG
AAGGACTTGCCGGCGGTGGAGGAGCTGGAGCGGCGGTGCCAGGTCGGCCTGTCCGGCGAC
ATGGCCGCGGTTCACGACCACGCCGACGACGGCGACGGCGCCGCCGCCAAGGAGAAGAAG
AAGACCAAGACGAAGACGAAGAAGAAGAAGGCGAGCATGTCTCTCTGCGTCGAGCAGATC
GGCGACCCGCTCGCCAGAGTCCGCCACGCCCCGGAACACGTCATGCTGGTGGCGGAGTAC
GGCGAGGAGGAGGAGAAGAAGAAGGTGGTGGGTGTGATCAAGGCGTGCGTGAAGACGGTG
AGCCGTGGCGGGAAGCAGGAGAAGCCATTCGTGAAGGTCGCCAACCTCCTCGGCCTCAGG
GTGTCGCCATCTCACAGGCGGCTGGGGATCGGGACGGCGCTGGTGAGGCGGGCGGAGGAG
TGGTGCGTGGCGAGGGGAGCGGAGCACGCGACGATGGCGACGACGGAGTCGAACGCGGCG
TCGCTGGCGCTGTTCACGGGGAGGTTCGGGTACGCGCCGTTCAGGCGGCCGGAGTTCATC
GGCCACCCGGTGCACGCGCACCGGCTGCCGGTGGCGAGGGGGCACCGCGTGTTCCAGCTG
CCCCCCGAGGTCGCCGCGGCGGCGTACGCGCGGCTGCTCCCGCCGCAGGACGCCGAGTTC
CTCCCCGCCGACATGCCCGCGCTGCTCGCACACAAGCTCACCCTCGGCACCTTCGTCGCC
GTCGCCGCTGACGGCGCGTCGTTCGCCGTGCTCAGCGTCTGGGACTCCACACGCTCGCTC
AGCCTCCGCGTGAGCGGCGCCCCGGCGCTGCTCCGCGCGTCGCTCGCCGCGCTCCGGGCG
CTCGACCGCGGTGCGCCGTGGCTGCACCTCCCCTCCATCCCGGACATCTTCCGCCCCTTC
GGCGCCTACCTCCTCTACGGCCTCCGCATGTCCGGCCCGGACGGCCCGGCGCTGCTCCGG
TCGCTCTGCCACCACGCCCACAACGTCGCCCGCAAGAACCCGGCGTGCGCCGTCGTCGCC
GCCGACATCTCCCCCGACGACCCGGCCGCCGCCGCCGTCCCGCGGTGGCGCCGCTTCTGC
TGCGACGAGGACGTCTGGTGCATCAAGAACCTCAACCCGGACGAACACGACGCCGACGAC
TGGGCGGCGCCGCCGCCGCCGCCGGGACGCCACCTCTTCGTCGACCCCCGCGAGTTCTAA

Protein

420 aa

>Os06t0650300-01 Histone H4 acetyltransferase, Regulation of grain weight, yield, and plant biomass
MVETTTMMKVLVRVREFDVEKDLPAVEELERRCQVGLSGDMAAVHDHADDGDGAAAKEKK
KTKTKTKKKKASMSLCVEQIGDPLARVRHAPEHVMLVAEYGEEEEKKKVVGVIKACVKTV
SRGGKQEKPFVKVANLLGLRVSPSHRRLGIGTALVRRAEEWCVARGAEHATMATTESNAA
SLALFTGRFGYAPFRRPEFIGHPVHAHRLPVARGHRVFQLPPEVAAAAYARLLPPQDAEF
LPADMPALLAHKLTLGTFVAVAADGASFAVLSVWDSTRSLSLRVSGAPALLRASLAALRA
LDRGAPWLHLPSIPDIFRPFGAYLLYGLRMSGPDGPALLRSLCHHAHNVARKNPACAVVA
ADISPDDPAAAAVPRWRRFCCDEDVWCIKNLNPDEHDADDWAAPPPPPGRHLFVDPREF*

CDS

chr06:26593177..26593464 (- strand) : 288 bp

chr06:26592833..26592981 (- strand) : 149 bp

chr06:26591905..26592727 (- strand) : 823 bp

FASTA

>Os06t0650300-01 class=Sequence position=chr06:26591905..26593464 (- strand)
ATGGTGGAGA CGACGACGAT GATGAAGGTG TTGGTGAGGG TGAGGGAGTT CGACGTGGAG AAGGACTTGC CGGCGGTGGA
GGAGCTGGAG CGGCGGTGCC AGGTCGGCCT GTCCGGCGAC ATGGCCGCGG TTCACGACCA CGCCGACGAC GGCGACGGCG
CCGCCGCCAA GGAGAAGAAG AAGACCAAGA CGAAGACGAA GAAGAAGAAG GCGAGCATGT CTCTCTGCGT CGAGCAGATC
GGCGACCCGC TCGCCAGAGT CCGCCACGCC CCGGAACACG TCATGCTGGT AATATCATCG ATCTAACTAA TCTAATCTAA
ACTAATCGAT TCTGATCAGA TTCACAAACA TGCATTACAT ATAAACATCC ATGAAATGAT CGTGTGGTTG ATGATCATGT
CTCTAATTAA GCCGATCAGA CGAGATGTAC GAACACGAAT GGTTAATTAA CATGGTGGTT GATTGGATTT GTGTGTGTTA
CAGGTGGCGG AGTACGGCGA GGAGGAGGAG AAGAAGAAGG TGGTGGGTGT GATCAAGGCG TGCGTGAAGA CGGTGAGCCG
TGGCGGGAAG CAGGAGAAGC CATTCGTGAA GGTCGCCAAC CTCCTCGGCC TCAGGGTGTC GCCATCTCAC AGGTGATTCC
TTTGATCATT CATGGTGCAC ACCAACATTG CTCTTGCTTC TTCCAGCAAT GGCGTCCAAT GCAAGGCTGA TGGTGTGATT
TGTGTTTGTG TTTGTAGGCG GCTGGGGATC GGGACGGCGC TGGTGAGGCG GGCGGAGGAG TGGTGCGTGG CGAGGGGAGC
GGAGCACGCG ACGATGGCGA CGACGGAGTC GAACGCGGCG TCGCTGGCGC TGTTCACGGG GAGGTTCGGG TACGCGCCGT
TCAGGCGGCC GGAGTTCATC GGCCACCCGG TGCACGCGCA CCGGCTGCCG GTGGCGAGGG GGCACCGCGT GTTCCAGCTG
CCCCCCGAGG TCGCCGCGGC GGCGTACGCG CGGCTGCTCC CGCCGCAGGA CGCCGAGTTC CTCCCCGCCG ACATGCCCGC
GCTGCTCGCA CACAAGCTCA CCCTCGGCAC CTTCGTCGCC GTCGCCGCTG ACGGCGCGTC GTTCGCCGTG CTCAGCGTCT
GGGACTCCAC ACGCTCGCTC AGCCTCCGCG TGAGCGGCGC CCCGGCGCTG CTCCGCGCGT CGCTCGCCGC GCTCCGGGCG
CTCGACCGCG GTGCGCCGTG GCTGCACCTC CCCTCCATCC CGGACATCTT CCGCCCCTTC GGCGCCTACC TCCTCTACGG
CCTCCGCATG TCCGGCCCGG ACGGCCCGGC GCTGCTCCGG TCGCTCTGCC ACCACGCCCA CAACGTCGCC CGCAAGAACC
CGGCGTGCGC CGTCGTCGCC GCCGACATCT CCCCCGACGA CCCGGCCGCC GCCGCCGTCC CGCGGTGGCG CCGCTTCTGC
TGCGACGAGG ACGTCTGGTG CATCAAGAAC CTCAACCCGG ACGAACACGA CGCCGACGAC TGGGCGGCGC CGCCGCCGCC
GCCGGGACGC CACCTCTTCG TCGACCCCCG CGAGTTCTAA