Os06t0654900-01

Locus

Os06g0654900

Description

Similar to CONSTANS-like protein CO6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBX20, OsE, OsCCT23, BBX20, CCT23

Oryzabase Gene Name Synonym(s)

B-box-containing protein 20, CCT domain-containing gene 23, CCT (CO, CO-LIKE and TOC1) domain protein 23, CCT domain protein 23, CONSTANS-like gene E

Transcript Evidence

AK243265 (DDBJ, Best hit)

Protein Evidence

NP_001148229.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

CCT domain (IPR010402)

Full-length cDNA

J100049E07 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0654900-01)

Others

Oryzabase (11650)

Transcript

563 bp

>Os06t0654900-01 Similar to CONSTANS-like protein CO6.
GTCGACGTGGGCGTGGTGCCGGAGCGGGCGGCGGCGATGGGGGAAGGGAGGGAGGCGAGG
CTGATGAGGTACAGGGAGAAGCGGAAGAACCGGCGGTTCGAGAAGACGATCCGGTACGCG
TCGCGCAAGGCCTACGCCGAGACGCGCCCCCGGATCAAGGGCCGCTTCGCCAAGCGCGCC
GACCACGACGCCGACGACGCCGACGCCGACGCCGACGACCCCGCCGCCGTCCCATCCTCC
TACATGCTCGACTTCGGCTACGGCGTCGTCCCGTCCTTCTGATCGCCGCCCGCCGCCGGC
CACCGCCGCCGCGCCGTCGCTTGTAATCTTGTATCAAATCGATCGATCGATGTGTAGGGG
CGTAGTAATCCCATGTAGTACTCATTTTGAGCTAGCTCACGCTAGTTTTGTACACTACTA
CTGCTACTAATTACGTGCTTACTACTTAGTGGTAATTATTTTTTTGATCAGCAAGATCAT
CTATATTGTATTAGCTCCCCCCAACGAATAAATCACAACTATATGGTATTATTCATCAGC
TAGGAATTGTTGATGGAAACAAA

CDS

246 bp

>Os06t0654900-01 Similar to CONSTANS-like protein CO6.
ATGGGGGAAGGGAGGGAGGCGAGGCTGATGAGGTACAGGGAGAAGCGGAAGAACCGGCGG
TTCGAGAAGACGATCCGGTACGCGTCGCGCAAGGCCTACGCCGAGACGCGCCCCCGGATC
AAGGGCCGCTTCGCCAAGCGCGCCGACCACGACGCCGACGACGCCGACGCCGACGCCGAC
GACCCCGCCGCCGTCCCATCCTCCTACATGCTCGACTTCGGCTACGGCGTCGTCCCGTCC
TTCTGA

Protein

82 aa

>Os06t0654900-01 Similar to CONSTANS-like protein CO6.
MGEGREARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRADHDADDADADAD
DPAAVPSSYMLDFGYGVVPSF*

5'UTR

chr06:26843645..26843680 (- strand) : 36 bp

CDS

chr06:26843399..26843644 (- strand) : 246 bp

3'UTR

chr06:26843118..26843398 (- strand) : 281 bp

FASTA

>Os06t0654900-01 class=Sequence position=chr06:26843118..26843680 (- strand)
GTCGACGTGG GCGTGGTGCC GGAGCGGGCG GCGGCGATGG GGGAAGGGAG GGAGGCGAGG CTGATGAGGT ACAGGGAGAA
GCGGAAGAAC CGGCGGTTCG AGAAGACGAT CCGGTACGCG TCGCGCAAGG CCTACGCCGA GACGCGCCCC CGGATCAAGG
GCCGCTTCGC CAAGCGCGCC GACCACGACG CCGACGACGC CGACGCCGAC GCCGACGACC CCGCCGCCGT CCCATCCTCC
TACATGCTCG ACTTCGGCTA CGGCGTCGTC CCGTCCTTCT GATCGCCGCC CGCCGCCGGC CACCGCCGCC GCGCCGTCGC
TTGTAATCTT GTATCAAATC GATCGATCGA TGTGTAGGGG CGTAGTAATC CCATGTAGTA CTCATTTTGA GCTAGCTCAC
GCTAGTTTTG TACACTACTA CTGCTACTAA TTACGTGCTT ACTACTTAGT GGTAATTATT TTTTTGATCA GCAAGATCAT
CTATATTGTA TTAGCTCCCC CCAACGAATA AATCACAACT ATATGGTATT ATTCATCAGC TAGGAATTGT TGATGGAAAC
AAA

Locus: Os06g0654900

Loading...

Locus: Os06g0654900

Loading...