Os06t0658900-01

Locus

Os06g0658900

Description

Homogentisate phytyltransferase (HPT), Tocopherol (vitamin E) biosynthesis, Plant development, Cold tolerance

RAP-DB Gene Symbol Synonym(s)

OsSGD1, OsVTE2, SGD1

RAP-DB Gene Name Synonym(s)

small grain and dwarf1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsVTE2, VTE2, SGD1, RTD1, OsHPT, HPT

Oryzabase Gene Name Synonym(s)

VITAMIN E DEFICIENT 2, small grain and dwarf1, small grain and dwarf 1, Rice tocopherol de chancy 1, homogentisate phytyltransferase

Transcript Evidence

AK243323

Protein Evidence

B7FA90

Literature

PMID: 28554480

PMID: 25098603

Note

Manual Curation

June 1, 2017

Gene Ontology (GO)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

UbiA prenyltransferase family (IPR000537)

Experimentally confirmed subcellular location

plastid (GO:0009536)

Full-length cDNA

J100057F06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0658900-01)

Others

Oryzabase (18215)

KEGG (Os06t0658900-01 (EC:2.5.1.115))

Transcript

1660 bp

>Os06t0658900-01 Homogentisate phytyltransferase (HPT), Tocopherol (vitamin E) biosynthesis, Plant development, Cold tolerance
gccacctcctcttctcctgcagcgtccacgcctccctccctcacgcctcgcctcgcctcg
cccgcccactcactccactcccccccgcagccgccgcgcgcgcccggccgccgcggtggt
ggcggcggcggcgatggattcgctgcgcctccggccgtcgctcctcgccgcgcgggcccc
cggcgcggccTCGCTGCCGCCTCTCCGGCGAGATCACTTTCTACCACCTTTATGTTCTAT
CCATAGAAATGGTAAACGGCCAGTTTCTTTGTCCAGCCAAAGGACCCAAGGTCCTTCCTT
CGATCAATGTCAGAAATTCTTTGGTTGGAAATCCTCCCACCACAGGATACCACATCGACC
AACATCTAGTTCCGCTGACGCTTCGGGACAACCTCTACAATCTTCAGCTGAAGCACATGA
TTCATCAAGTATATGGAAGCCAATATCATCTTCTCTGGATGCATTTTACAGGTTTTCTCG
GCCACATACTGTCATAGGAACAGCACTTAGCATAGTCTCAGTTTCGCTGCTAGCTGTTGA
GAATTTGTCCGATGTGTCTCCCTTGTTCCTCACTGGTTTGCTGGAGGCAGTGGTAGCAGC
TCTTTTCATGAACATCTATATCGTTGGATTGAATCAGTTGTTCGACATTGAGATAGATAA
GGTTAACAAGCCAACTCTTCCATTAGCATCTGGGGAATATTCTCCTGCAACTGGAGTTGC
ACTTGTATCAGCCTTCGCTGCTATGAGCTTTGGCCTTGGATGGGCTGTTGGATCACAGCC
TCTGTTCCTGGCTCTTTTCATTAGCTTTATTCTTGGAACAGCATATTCGATTAATCTGCC
ATTCCTGAGATGGAAGAGATCTGCTGTTGTTGCAGCACTTTGCATATTAGCAGTCCGTGC
AGTGATTGTTCAGCTGGCATTTTTTCTCCACATTCAGACATTCGTATTCAGAAGACCAGC
AGTCTTTACCAGGCCATTGATTTTTGCAACTGCATTCATGACCTTTTTCTCCGTTGTAAT
AGCATTGTTCAAGGATATACCTGATATTGAAGGAGACCGTATTTTTGGTATCAAATCTTT
CAGTGTTCGATTAGGTCAAAAGAAGGTTTTCTGGATTTGTGTTGGTCTGCTCGAGATGGC
TTATTGTGTTGCAATATTGATGGGAGCTACTTCTGCCTGTTTGTGGAGCAAATACGCAAC
TGTGGTGGGACATGCAATCCTTGCGGCAATCCTATGGAACCGCTCACGGTCGATTGATCT
GACAAGCAAAACTGCAATCACTTCTTTCTACATGTTTATCTGGAAGCTGTTCTACGCGGA
ATACCTTCTCATTCCTCTTGTAAGGTGACAAAGGCGATTACTCCAGGGACGCAGGTAGAT
TGGAATTGGATCATGGCTGGATGGATGAACGGACGGCGCCCCATAAAATCACCTGCAAAT
CACCCGGTACACATGTTGACATCCTGCATCCAGATATGATATTGATAGATCATCGTCGGC
ACCATCATTCCTCTGAAAGATTTCGCACGGCATTTCAACCTCCAACTCCCAACGTACCCC
AAAAAAAGTAACTAGGCCAGGTGAGCATCTGCTAGCCTATAGTAGACGTTATTGGAACAG
TGGTAGTACTTGTTAGCAGCAGTAATAATAATCATCATAA

CDS

1215 bp

>Os06t0658900-01 Homogentisate phytyltransferase (HPT), Tocopherol (vitamin E) biosynthesis, Plant development, Cold tolerance
atggattcgctgcgcctccggccgtcgctcctcgccgcgcgggcccccggcgcggccTCG
CTGCCGCCTCTCCGGCGAGATCACTTTCTACCACCTTTATGTTCTATCCATAGAAATGGT
AAACGGCCAGTTTCTTTGTCCAGCCAAAGGACCCAAGGTCCTTCCTTCGATCAATGTCAG
AAATTCTTTGGTTGGAAATCCTCCCACCACAGGATACCACATCGACCAACATCTAGTTCC
GCTGACGCTTCGGGACAACCTCTACAATCTTCAGCTGAAGCACATGATTCATCAAGTATA
TGGAAGCCAATATCATCTTCTCTGGATGCATTTTACAGGTTTTCTCGGCCACATACTGTC
ATAGGAACAGCACTTAGCATAGTCTCAGTTTCGCTGCTAGCTGTTGAGAATTTGTCCGAT
GTGTCTCCCTTGTTCCTCACTGGTTTGCTGGAGGCAGTGGTAGCAGCTCTTTTCATGAAC
ATCTATATCGTTGGATTGAATCAGTTGTTCGACATTGAGATAGATAAGGTTAACAAGCCA
ACTCTTCCATTAGCATCTGGGGAATATTCTCCTGCAACTGGAGTTGCACTTGTATCAGCC
TTCGCTGCTATGAGCTTTGGCCTTGGATGGGCTGTTGGATCACAGCCTCTGTTCCTGGCT
CTTTTCATTAGCTTTATTCTTGGAACAGCATATTCGATTAATCTGCCATTCCTGAGATGG
AAGAGATCTGCTGTTGTTGCAGCACTTTGCATATTAGCAGTCCGTGCAGTGATTGTTCAG
CTGGCATTTTTTCTCCACATTCAGACATTCGTATTCAGAAGACCAGCAGTCTTTACCAGG
CCATTGATTTTTGCAACTGCATTCATGACCTTTTTCTCCGTTGTAATAGCATTGTTCAAG
GATATACCTGATATTGAAGGAGACCGTATTTTTGGTATCAAATCTTTCAGTGTTCGATTA
GGTCAAAAGAAGGTTTTCTGGATTTGTGTTGGTCTGCTCGAGATGGCTTATTGTGTTGCA
ATATTGATGGGAGCTACTTCTGCCTGTTTGTGGAGCAAATACGCAACTGTGGTGGGACAT
GCAATCCTTGCGGCAATCCTATGGAACCGCTCACGGTCGATTGATCTGACAAGCAAAACT
GCAATCACTTCTTTCTACATGTTTATCTGGAAGCTGTTCTACGCGGAATACCTTCTCATT
CCTCTTGTAAGGTGA

Protein

405 aa

>Os06t0658900-01 Homogentisate phytyltransferase (HPT), Tocopherol (vitamin E) biosynthesis, Plant development, Cold tolerance
MDSLRLRPSLLAARAPGAASLPPLRRDHFLPPLCSIHRNGKRPVSLSSQRTQGPSFDQCQ
KFFGWKSSHHRIPHRPTSSSADASGQPLQSSAEAHDSSSIWKPISSSLDAFYRFSRPHTV
IGTALSIVSVSLLAVENLSDVSPLFLTGLLEAVVAALFMNIYIVGLNQLFDIEIDKVNKP
TLPLASGEYSPATGVALVSAFAAMSFGLGWAVGSQPLFLALFISFILGTAYSINLPFLRW
KRSAVVAALCILAVRAVIVQLAFFLHIQTFVFRRPAVFTRPLIFATAFMTFFSVVIALFK
DIPDIEGDRIFGIKSFSVRLGQKKVFWICVGLLEMAYCVAILMGATSACLWSKYATVVGH
AILAAILWNRSRSIDLTSKTAITSFYMFIWKLFYAEYLLIPLVR*

5'UTR

chr06:27087548..27087680 (+ strand) : 133 bp

CDS

chr06:27087681..27087759 (+ strand) : 79 bp

chr06:27088559..27088848 (+ strand) : 290 bp

chr06:27088980..27089063 (+ strand) : 84 bp

chr06:27089150..27089224 (+ strand) : 75 bp

chr06:27089363..27089446 (+ strand) : 84 bp

chr06:27089831..27089920 (+ strand) : 90 bp

chr06:27090468..27090565 (+ strand) : 98 bp

chr06:27091111..27091210 (+ strand) : 100 bp

chr06:27091307..27091378 (+ strand) : 72 bp

chr06:27091444..27091539 (+ strand) : 96 bp

chr06:27092152..27092256 (+ strand) : 105 bp

chr06:27092456..27092497 (+ strand) : 42 bp

3'UTR

chr06:27092498..27092515 (+ strand) : 18 bp

chr06:27092599..27092892 (+ strand) : 294 bp

FASTA

>Os06t0658900-01 class=Sequence position=chr06:27087548..27092892 (+ strand)
gccacctcct cttctcctgc agcgtccacg cctccctccc tcacgcctcg cctcgcctcg cccgcccact cactccactc
ccccccgcag ccgccgcgcg cgcccggccg ccgcggtggt ggcggcggcg gcgatggatt cgctgcgcct ccggccgtcg
ctcctcgccg cgcgggcccc cggcgcggcc TCGCTGCCGC CTCTCCGGCG AGGTAAGTCG CTGCGGCTCA CCCTCCCCTT
AGCTTCCTCT GCATGCAGTG TGATGTGAGC GTGTGTGATT GGAGAGTACT TCGGTGATAA ACTGACTTGG GCTTGCGCTG
TAGATATTCA GACCAGTAGT GTTTTTTTTT TCTTTTTTCA TGCCGGATTT GTTAGGCTGG GAGTTTTTTT TGTTAGGTTG
GAAGTGTGAT GTGAACCTTA CTTCATCCAG TATAAGATGC AGAGAAAAAC ATTTTGAATT GGTAGAGTAG GGGATTTGAT
TACTGAAGGT TTTTGTGAGT GATCAGGTCA TGCCAATTTT ATCTCATGGG AAGACAGATT TATTACTGAA GGTTTATACT
GATGTAGTAG TAGTAGTACT ACAGAAAGTA GTTTCAACAC TATATATGTG TAACTGTTCT CTCCGACTCT CTATCAGATG
GTTGCAGCTT GTGTGAGTAA TCACCATGCA ATAGACATAA CATGTTTGTG TGTCGGCAAA GTAAGTCAAA CAATCTTTTC
AACTGACAGA AATGACTGAC CTGATCCTGC TGTATTAAGA CATACGAGGC AAAGCTTTTG CCCTCCTTTG AAAAGAAAAG
GCTGATCTGA TGCGAGGGAA GCATGACAAA ACTGTTTCAG TGTTTCTTCT TTGACTGCTC CTATGTAGTA CAGTGGTAGT
AGAATATCCA CGGTTTTATG ACATAACAAG TGATATGTGA ACATAATAAG TGATATTTGG GTAATTTGTT TCTCCATCTT
TCTTTCATTA GTGCTTGACG TAGTTTTGAA ATGCTGATTT TTCTTTTCCA GATCACTTTC TACCACCTTT ATGTTCTATC
CATAGAAATG GTAAACGGCC AGTTTCTTTG TCCAGCCAAA GGACCCAAGG TCCTTCCTTC GATCAATGTC AGAAATTCTT
TGGTTGGAAA TCCTCCCACC ACAGGATACC ACATCGACCA ACATCTAGTT CCGCTGACGC TTCGGGACAA CCTCTACAAT
CTTCAGCTGA AGCACATGAT TCATCAAGTA TATGGAAGCC AATATCATCT TCTCTGGATG CATTTTACAG GTTTTCTCGG
CCACATACTG TCATAGGAAC AGTTAAGTGG TGCTGCTATG TTTCAATTTA GGCGCACTTC AGTGCCCAAG ATATTTGAGT
GAAGCTAATG TCCTTGTGTT GCGCTTTCCT TTTGTTCTCT CCTCAACTAA GAGATTTTGC TTGTTTAATC AGGCACTTAG
CATAGTCTCA GTTTCGCTGC TAGCTGTTGA GAATTTGTCC GATGTGTCTC CCTTGTTCCT CACTGGTTTG CTGGAGGTAC
AACTTGAAGC AGCACATTTA CTTTATATTC CCCCAAGATG GATAAAAGTT TTCACTACAT TTGCTTTGTT ACACTTGTGC
AGGCAGTGGT AGCAGCTCTT TTCATGAACA TCTATATCGT TGGATTGAAT CAGTTGTTCG ACATTGAGAT AGATAAGGTA
CTTTGAATCC ACTGTAATCT GTTTGTTAAA AAATGAATCC ACTGTAATCT CAAATGTTAA TTTTGTACTA ATTGCACTGT
CTTTTACTAT CTTTATTCCA AACTGTTTTG GGTGCTAATA TTGCTATCTC TTCAGGTTAA CAAGCCAACT CTTCCATTAG
CATCTGGGGA ATATTCTCCT GCAACTGGAG TTGCACTTGT ATCAGCCTTC GCTGCTATGG TAAATAAGCT TCTTTGGTCC
AGAAAATAAG AAAAACAATC TTCTTGTTAT GTTTTTTAAT ATGCGGGTCA TGAAATGCTG AAATTGGCTG TTCAAGCACA
TGGTTTGTTT TGAACATTCC TTTTTAATGT TAGCCTTTAG AACTAGTGGT TTTCATTTGC GAGAAGATAA AAGTAGCAGA
ATGGAGATAC ACCTTTCTTA TATGGTTGAG CAATTGCACT CCAGAAAGTT TATTTATTAC TATGCGCAGA TAATTAAATC
TAATGCAGTT TGTTTGTATT TTCTGCCATT GTGCTCATCT GATCAAGAGC TATAAATAAT TTGCTTATTT TGGTTCTTAG
TCTGTCAGAC TGATTCGGAA CGTGTTCTAT GTGAATATTG CAGAGCTTTG GCCTTGGATG GGCTGTTGGA TCACAGCCTC
TGTTCCTGGC TCTTTTCATT AGCTTTATTC TTGGAACAGC ATATTCGATT AATGTAAGAG ACATATATCT TTAGCTCCCT
CTTTTGTATT TTTCAAATTA ATAAATAATA GTAGAACCAA CTATTTGTAG ATTCATAGTA TGCCCTTTCA TTGATCTTAA
TATCTTATCT TATGTACTGC AATGCAAAAC TTTAGTAGGA CAACTTATTT CTACTTTTTA AGGAATGTAT TTCCTACTAT
AAACCAAACC ACAAAACGTG GCTCCAGAGG TTTAGTGGGC TGGGCAGATT TTACTGATAC AAAGCTTAAC TTGCAGTCAG
TCTCCCCTCA AAGTTTACTA GCCAATATCA GCAATAAAAG TTTTTCAAAA CGTGGCTATG TTAAATATTA TCTGGTACTC
CTTTCAGTGC ATTTTTGGAC CTCCAATCAT CCACATATTT TTACTTCAAA AGAAAAAAAA ATGAAATGGA TGCTTTGACA
TGAACTTGTT TTTTCAGTTC CTGCATGTTT TTTTTCAACG TTAATGGCTT TTTATGTTGC TAGCATTTTC CGACACTTTT
ATTACCAAAA GAGCTGACAT TCCATTTTAT TCCTCCACAG CTGCCATTCC TGAGATGGAA GAGATCTGCT GTTGTTGCAG
CACTTTGCAT ATTAGCAGTC CGTGCAGTGA TTGTTCAGCT GGCATTTTTT CTCCACATTC AGGCGAGTCT TCAGTGACAA
CCTCAAAAAT AAGAAAAAAA ATCATTGGTG AAAATCAGTA CGTTTGTCAA TTGCAGTTGC ATTTTCATGT GGAACATTAT
CTAAAATTAG ATTGTCTGGT CTGGTCAATT TCATTGTGCT GTATTGTTGT TCTTTAGAGA TTCCTAAGTT TTCAATACCT
TGACCTTTAT CTGCATATTT TTATTAGTAC AAACATGCTG CTCTCCTGTG CTTTCTTTAA AAGAATAGAG ACTCCTAAAT
TTTTCACCTC TACTTTTGCT TGGAATATAT CTTAAAGAAT GCTGTTGTAT ATGTTTGGAT AATCGGATCT CTTTCTTATA
TTTTGAGTTT AATATGCCAT GGTTGTTGAT AGCTGTAATT AGGATCCACC AAATAAGAGT AGACGCTTCT TTTTTGTGAG
AATTATCTGC ACCTTTCTAT TATTCCAGGA GCTTTTACCA TGGATTATCA GATATTATGA TCATATGAAC AGATAATTGC
ATAGCACATT ATCTTATCCT AACGATCTAT TCATGCAAAT ATATCAGACA TTCGTATTCA GAAGACCAGC AGTCTTTACC
AGGCCATTGA TTTTTGCAAC TGCATTCATG ACCTTTTTCT CCGTTGTAAT AGCATTGTTC AAGGTAATAT TCTGTACTTA
TCTGGAAGGT AACTCCCTAT AAAATCTAGC TGCAGAAGTG GTCGGATTCG CCTTAATAAA ATTTGCTGTT TCCGTGTAGG
ATATACCTGA TATTGAAGGA GACCGTATTT TTGGTATCAA ATCTTTCAGT GTTCGATTAG GTCAAAAGAA GGTTAGTGCA
AAAGTGCACT TCTCAGAGAA TTACTCTTCT ACTTGTTGAT ACAAACATCC GAACAGGTTT TCTGGATTTG TGTTGGTCTG
CTCGAGATGG CTTATTGTGT TGCAATATTG ATGGGAGCTA CTTCTGCCTG TTTGTGGAGC AAATACGCAA CTGTATGGAT
CACCTCTCTT GCGACTCAGC AGCATTATTA ATGATTAGTT TTGGTTATGA ACTATGATTT ATTTATTATT TATATATGCC
AGGTGTTTTC GGATTGTCAA ATTTACTTTG TTAAGCTAAC CAGTATTAGA CTAGATTCAA TTATGGTTGA TTACCACTGC
CAGTTCTTAA AAGAAATAAA TTAGTGTCAG TTCTAGCATC TTAAGCTATC TGCAGAAGGC TCTGTTTGGA TGGTCCAATT
CTGGCCTGGA TTCCAGCTGG TGCCAATAAT TATTTTGGGC CAGGATCGAT CCTGCTTGGG TTTGTAGCAT CCAAACAAAG
CCATAACTGC TGGGCTGGGC TATGTTTTCT TTACAGAGTA TTAAAATTGT TTCGACTTTT GTGTCTGGAA GCCCACGGCT
GTGTGTTTTG TTGAATTTGC CTTCTACCTT TTGTGATAAA CTTGTTTACC TGTCCAGATC TTTCCTAGAA TACAGTTCTA
GTGATTAACC TGGCACCTGT CAGGCTTTCA TGGACTGTGA TGTATGCTTC TTCGAGATTT GTTTATCTTT TTTAAGATAA
TGTTCCTGGT TTGTTTATGA AGTGGAATTT ATATTCTTTT GAAGGTGGTG GGACATGCAA TCCTTGCGGC AATCCTATGG
AACCGCTCAC GGTCGATTGA TCTGACAAGC AAAACTGCAA TCACTTCTTT CTACATGTTT ATCTGGAAGG TAATTACCTC
GTCTCCAAAA TCTGTTCCTG ATCTTTCACC CACTTTCCTG CCCTCCTTGA CAAATTCCTG CTACGTACTA CTGTACTGCC
CCAGCTCAAT CAATTGGTTG TTTACCTTCT TCAGCTCGCG TATCCTGAAA CAATCCAATC GCTAATTAAA CGCTAACCCA
TTTACTTCCC CCCACATGGT TTGTGCAGCT GTTCTACGCG GAATACCTTC TCATTCCTCT TGTAAGGTGA CAAAGGCGAT
TACTCCAGGT ACGGGACAAC TTTGAGTGCC GGAGTAAACT CACTTCTGCT AATTTCTGAA AAGCTCAAAC AAACCTCGTC
AATTCTGGTA GGGACGCAGG TAGATTGGAA TTGGATCATG GCTGGATGGA TGAACGGACG GCGCCCCATA AAATCACCTG
CAAATCACCC GGTACACATG TTGACATCCT GCATCCAGAT ATGATATTGA TAGATCATCG TCGGCACCAT CATTCCTCTG
AAAGATTTCG CACGGCATTT CAACCTCCAA CTCCCAACGT ACCCCAAAAA AAGTAACTAG GCCAGGTGAG CATCTGCTAG
CCTATAGTAG ACGTTATTGG AACAGTGGTA GTACTTGTTA GCAGCAGTAA TAATAATCAT CATAA

Locus: Os06g0658900

Loading...

Locus: Os06g0658900

Loading...