Os06t0659400-01

Locus

Os06g0659400

Description

Protein of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL29, TBL29

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 29

Transcript Evidence

AK106651 (DDBJ, Best hit)

Protein Evidence

A2YFU3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

002-113-F10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0659400-01)

RiceXPro (AK106651)

Others

Oryzabase (21484)

KEGG (Os06t0659400-01)

Transcript

1621 bp

>Os06t0659400-01 Protein of unknown function DUF231, plant domain containing protein.
actgctcggctcgactcctcctgctagctcgcccgtatccagctctaccttcgccggcgg
tggcggcggtgatcggtggtcctcgatcgatgccgccgccgctcccgtggcggcgcctcg
tcgtcccgctcctcgccgtcgtctccgtgcctttcgttctcccgctcgcactcccgttcc
tcctccgctcctcctcctctcgccagccgctctccgtccaccgcctcgactggctccctc
ctctgtccccgctgcctcgcaccccggatccatcaactccgccgccgccgccattgacgc
tcccgttggcgccactgaccactccgccgccgccgccgccatcgactctcccgatggcac
caccaacgaggtcgtcgccggccgcttccccGCCGCCTCCCGAGAAGGGCGAGGGTGGAG
GAACGACATGCGACTTGTACGATGGGGAGTGGGCTCGCGACGAGGCGGCACGGCCGCTGT
ACGCGCCGGGGACGTGCCCCTACGTCGACGAGGCGTACGCCTGCGCGTCGAACGGCCGGC
CGGACGCCGCGTACACGCGGTGGCGATGGGCGCCGCGGCGGTGCCGCCTCCCCAGGTTCA
ACGCGACGGATTTCCTGGCGACGCTGCGGGGCAAGCGGCTGATGCTCGTCGGCGACTCCA
TGAACCGGAACCAGTTCGAGTCCCTGCTCTGCATCCTCCGCGAGGCCATCCCGGACAAGA
CGAGGATGTTCGAGACCCACGGCTACAGGATCAGCAAGGGCCGCGGCTACTTCGTCTTCA
AGTTCGTGGATTACGACTGCACTGTTGAGTTCGTGCGATCGCATTTCCTTGTCCGGGAAG
GCGTGCGCTACAATCGGCAGAAGAACTCCAACCCGATCCTCCAGATTGACCGGATCGACA
AGTCGGCGAGCCGGTGGAGGAAGGTCGATGTCCTCGTCTTCAACACCGGCCACTGGTGGA
CGCACGGCAAGACGGCGAGAGGCATCAACTACTACAAGGAAGGCGACACGCTGTACCCAC
AATTCGACTCGACTGAAGCTTACAGGAGAGCTCTCAAGACCTGGGCTCGCTGGATCGACA
AGAACATGGACCCGGCCAAGAGTGTCGTCTTCTACCGAGGCTACTCCACTGCACATTTCA
GGGGAGGGGAGTGGGATTCGGGTGGGTCGTGCAGCGGGGAGAGGGAGCCGACGCTCAGAG
GGGCGGTGATCGGCAGCTACCCGCGGAAGATGAGGATCGTGGAGGAGGTGATCGGGAGGA
TGCGGTTCCCGGTGCGGCTGCTCAACGTGACGAAGCTGACCAACTTCCGCAGGGACGGCC
ACCCGTCGGTGTACGGCAAGGCGGCGGCGGGGAAGAAGGTGTCGAGGAGGAAGCAGGATT
GCAGCCACTGGTGCCTCCCCGGCGTGCCGGACGCGTGGAACGAGCTGATCTACGCGTCCC
TCGTGTTGGAACCCAAGCCCAGATCATGGAAACACCACTAGTACACTACTTCAGTTTCTT
TTTGTGTTTGTTTCGGTTTGAGCAGTTGAGCTGATGCGCAAACTGAAAATGTGCTTGATG
TTTGCTCAATTGAGGACAGGAGGTTTTGCCTTGCTTTTTGAGATGCAAAAGTCTTCCTCC
T

CDS

1392 bp

>Os06t0659400-01 Protein of unknown function DUF231, plant domain containing protein.
atgccgccgccgctcccgtggcggcgcctcgtcgtcccgctcctcgccgtcgtctccgtg
cctttcgttctcccgctcgcactcccgttcctcctccgctcctcctcctctcgccagccg
ctctccgtccaccgcctcgactggctccctcctctgtccccgctgcctcgcaccccggat
ccatcaactccgccgccgccgccattgacgctcccgttggcgccactgaccactccgccg
ccgccgccgccatcgactctcccgatggcaccaccaacgaggtcgtcgccggccgcttcc
ccGCCGCCTCCCGAGAAGGGCGAGGGTGGAGGAACGACATGCGACTTGTACGATGGGGAG
TGGGCTCGCGACGAGGCGGCACGGCCGCTGTACGCGCCGGGGACGTGCCCCTACGTCGAC
GAGGCGTACGCCTGCGCGTCGAACGGCCGGCCGGACGCCGCGTACACGCGGTGGCGATGG
GCGCCGCGGCGGTGCCGCCTCCCCAGGTTCAACGCGACGGATTTCCTGGCGACGCTGCGG
GGCAAGCGGCTGATGCTCGTCGGCGACTCCATGAACCGGAACCAGTTCGAGTCCCTGCTC
TGCATCCTCCGCGAGGCCATCCCGGACAAGACGAGGATGTTCGAGACCCACGGCTACAGG
ATCAGCAAGGGCCGCGGCTACTTCGTCTTCAAGTTCGTGGATTACGACTGCACTGTTGAG
TTCGTGCGATCGCATTTCCTTGTCCGGGAAGGCGTGCGCTACAATCGGCAGAAGAACTCC
AACCCGATCCTCCAGATTGACCGGATCGACAAGTCGGCGAGCCGGTGGAGGAAGGTCGAT
GTCCTCGTCTTCAACACCGGCCACTGGTGGACGCACGGCAAGACGGCGAGAGGCATCAAC
TACTACAAGGAAGGCGACACGCTGTACCCACAATTCGACTCGACTGAAGCTTACAGGAGA
GCTCTCAAGACCTGGGCTCGCTGGATCGACAAGAACATGGACCCGGCCAAGAGTGTCGTC
TTCTACCGAGGCTACTCCACTGCACATTTCAGGGGAGGGGAGTGGGATTCGGGTGGGTCG
TGCAGCGGGGAGAGGGAGCCGACGCTCAGAGGGGCGGTGATCGGCAGCTACCCGCGGAAG
ATGAGGATCGTGGAGGAGGTGATCGGGAGGATGCGGTTCCCGGTGCGGCTGCTCAACGTG
ACGAAGCTGACCAACTTCCGCAGGGACGGCCACCCGTCGGTGTACGGCAAGGCGGCGGCG
GGGAAGAAGGTGTCGAGGAGGAAGCAGGATTGCAGCCACTGGTGCCTCCCCGGCGTGCCG
GACGCGTGGAACGAGCTGATCTACGCGTCCCTCGTGTTGGAACCCAAGCCCAGATCATGG
AAACACCACTAG

Protein

464 aa

>Os06t0659400-01 Protein of unknown function DUF231, plant domain containing protein.
MPPPLPWRRLVVPLLAVVSVPFVLPLALPFLLRSSSSRQPLSVHRLDWLPPLSPLPRTPD
PSTPPPPPLTLPLAPLTTPPPPPPSTLPMAPPTRSSPAASPPPPEKGEGGGTTCDLYDGE
WARDEAARPLYAPGTCPYVDEAYACASNGRPDAAYTRWRWAPRRCRLPRFNATDFLATLR
GKRLMLVGDSMNRNQFESLLCILREAIPDKTRMFETHGYRISKGRGYFVFKFVDYDCTVE
FVRSHFLVREGVRYNRQKNSNPILQIDRIDKSASRWRKVDVLVFNTGHWWTHGKTARGIN
YYKEGDTLYPQFDSTEAYRRALKTWARWIDKNMDPAKSVVFYRGYSTAHFRGGEWDSGGS
CSGEREPTLRGAVIGSYPRKMRIVEEVIGRMRFPVRLLNVTKLTNFRRDGHPSVYGKAAA
GKKVSRRKQDCSHWCLPGVPDAWNELIYASLVLEPKPRSWKHH*

5'UTR

chr06:27148692..27148780 (+ strand) : 89 bp

CDS

chr06:27148781..27149286 (+ strand) : 506 bp

chr06:27149372..27149564 (+ strand) : 193 bp

chr06:27149640..27149833 (+ strand) : 194 bp

chr06:27150032..27150190 (+ strand) : 159 bp

chr06:27150271..27150610 (+ strand) : 340 bp

3'UTR

chr06:27150611..27150750 (+ strand) : 140 bp

FASTA

>Os06t0659400-01 class=Sequence position=chr06:27148692..27150750 (+ strand)
actgctcggc tcgactcctc ctgctagctc gcccgtatcc agctctacct tcgccggcgg tggcggcggt gatcggtggt
cctcgatcga tgccgccgcc gctcccgtgg cggcgcctcg tcgtcccgct cctcgccgtc gtctccgtgc ctttcgttct
cccgctcgca ctcccgttcc tcctccgctc ctcctcctct cgccagccgc tctccgtcca ccgcctcgac tggctccctc
ctctgtcccc gctgcctcgc accccggatc catcaactcc gccgccgccg ccattgacgc tcccgttggc gccactgacc
actccgccgc cgccgccgcc atcgactctc ccgatggcac caccaacgag gtcgtcgccg gccgcttccc cGCCGCCTCC
CGAGAAGGGC GAGGGTGGAG GAACGACATG CGACTTGTAC GATGGGGAGT GGGCTCGCGA CGAGGCGGCA CGGCCGCTGT
ACGCGCCGGG GACGTGCCCC TACGTCGACG AGGCGTACGC CTGCGCGTCG AACGGCCGGC CGGACGCCGC GTACACGCGG
TGGCGATGGG CGCCGCGGCG GTGCCGCCTC CCCAGGTAGT ACTAGTACTA GTACCCCGCC GCTGCCGCCG CTTCGTCGCT
CGAGCTCGCC ATGGCTGATC CGATCTCGCT AGGTCCGTAG GTTCAACGCG ACGGATTTCC TGGCGACGCT GCGGGGCAAG
CGGCTGATGC TCGTCGGCGA CTCCATGAAC CGGAACCAGT TCGAGTCCCT GCTCTGCATC CTCCGCGAGG CCATCCCGGA
CAAGACGAGG ATGTTCGAGA CCCACGGCTA CAGGATCAGC AAGGGCCGCG GCTACTTCGT CTTCAAGTTC GTGGTAATTA
ACCTCACTAA AACTGACAAA TGGAATCCAT GGCGGCGCAG CGTGACAGTA ATCATCGTTA TCCTGCAGGA TTACGACTGC
ACTGTTGAGT TCGTGCGATC GCATTTCCTT GTCCGGGAAG GCGTGCGCTA CAATCGGCAG AAGAACTCCA ACCCGATCCT
CCAGATTGAC CGGATCGACA AGTCGGCGAG CCGGTGGAGG AAGGTCGATG TCCTCGTCTT CAACACCGGC CACTGGTGGA
CGCACGGCAA GACGGCGAGA GGGTACGTAC CTACTCCCCC GTCTCTACCA AGAATCGGAT GGGACATGAC ATAGTATAGC
GAATCTGAAC AGAAGTCTGT CTAAATTTAG GTTTGATGTA CTATAGGATA GAGGGAACAT GTGCCATTGT TGTGCAGCTC
AAAGAAACCA ACCATTTTGG TGTCGCTAGC TGAATCCTGA TTGCTGAGCA ATGTGGGCAG CATCAACTAC TACAAGGAAG
GCGACACGCT GTACCCACAA TTCGACTCGA CTGAAGCTTA CAGGAGAGCT CTCAAGACCT GGGCTCGCTG GATCGACAAG
AACATGGACC CGGCCAAGAG TGTCGTCTTC TACCGAGGCT ACTCCACTGC ACATTTCAGG TAACCGAACC TGATCATCAC
TCGCCATTGC AACAATTTCA GTTCATCTTG ATTCAGATTT TAGTATCGAA TTTTGGCAGG GGAGGGGAGT GGGATTCGGG
TGGGTCGTGC AGCGGGGAGA GGGAGCCGAC GCTCAGAGGG GCGGTGATCG GCAGCTACCC GCGGAAGATG AGGATCGTGG
AGGAGGTGAT CGGGAGGATG CGGTTCCCGG TGCGGCTGCT CAACGTGACG AAGCTGACCA ACTTCCGCAG GGACGGCCAC
CCGTCGGTGT ACGGCAAGGC GGCGGCGGGG AAGAAGGTGT CGAGGAGGAA GCAGGATTGC AGCCACTGGT GCCTCCCCGG
CGTGCCGGAC GCGTGGAACG AGCTGATCTA CGCGTCCCTC GTGTTGGAAC CCAAGCCCAG ATCATGGAAA CACCACTAGT
ACACTACTTC AGTTTCTTTT TGTGTTTGTT TCGGTTTGAG CAGTTGAGCT GATGCGCAAA CTGAAAATGT GCTTGATGTT
TGCTCAATTG AGGACAGGAG GTTTTGCCTT GCTTTTTGAG ATGCAAAAGT CTTCCTCCT

Locus: Os06g0659400

Loading...

Locus: Os06g0659400

Loading...