Os06t0660200-01

Locus

Os06g0660200

Description

Auxin efflux transporter, Polar auxin transport, Control of canopy architecture

RAP-DB Gene Symbol Synonym(s)

OsPIN2, PIN2

RAP-DB Gene Name Synonym(s)

PIN PROTEIN 2, PIN-FORMED 2

CGSNL Gene Symbol

LRA1

CGSNL Gene Name

LARGE ROOT ANGLE1

Oryzabase Gene Symbol Synonym(s)

OsPIN2, PIN2, OsLRA1

Oryzabase Gene Name Synonym(s)

PIN-FORMED 2, large root angle 1, AUXIN EFFLUX CARRIER COMPONENT 2-LIKE

Transcript Evidence

AK101191

Protein Evidence

Q651V6

Literature

PMID: 21777365

PMID: 19825657

Note

Manual Curation

May 30, 2017

Gene Ontology (GO)

Biological Process: auxin efflux (GO:0010315)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: auxin efflux transmembrane transporter activity (GO:0010329)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Membrane transport protein (IPR004776)

Auxin efflux carrier, plant type (IPR014024)

Auxin efflux carrier component 2 (IPR033526)

Full-length cDNA

J033030G03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0660200-01)

RiceXPro (AK101191)

Others

Oryzabase (8933)

KEGG (Os06t0660200-01)

Transcript

2275 bp

>Os06t0660200-01 Auxin efflux transporter, Polar auxin transport, Control of canopy architecture
AATTAGCTCGTTCTCTTGTGTCAAGAAAAAAAAAGAAAGAAAAAGCTCGCCGCCGCCGCC
ACCGTCGCCGGCGCGATGATCACCGGACGCGACATCTACGACGTGCTGGCGGCGATCGTG
CCGCTGTACGTGGCGATGTTCCTGGCGTACGGGTCGGTGCGGTGGTGGGGGATATTCAcg
ccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctcc
ttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgac
tcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgc
taccgccgcaatggcggcgccgccgcgtcgctcGACTGGACCATCACCCTCTTCTCGCTG
TCCACGCTGCCCAACACGCTGGTCATGGGCATCCCGCTGCTCCGCGCCATGTACGGCGAC
TTCTCCGGCTCGCTCATGGTGCAGATCGTCGTGCTCCAGAGCGTCATCTGGTACACCCTC
ATGCTCTTCCTCTTCGAGTACCGCGGCGCCAAGGCGCTCATCTCCGAGCAGTTCCCGCCG
GACGTCGGCGCCAGCATCGCCTCGTTCCGCGTCGACTCCGACGTCGTCTCGCTCAACGGG
AGGGAGGCGCTGCAGGCGGACGCCGAGGTGGGGCGCGACGGCCGCGTCCACGTCGTCATC
CGCCGCTCCGCCTCGGCCTCCACCACGGGCGGCGGCGGCGGCGCGGCGCGCTCCGGCGTG
TCCCGGGCGTACGGCGCGTCCAACGCCATGACGCCGCGCGCCTCCAACCTCACCGGCGTG
GAGATCTACTCGCTGCAGACGTCGCGCGAGCCCACGCCGCGGGCGTCCAGCTTCAACCAG
GCCGACTTCTACGCCATGTTCTCCGGCAGCAAGATGGCCAGCCAGATGGCTAGCCCCATG
GCGCAGCACGGCGGCGCCGGCGGCCGCGCCCAGGGCCTCGACGAGCAGGTCACCAACAAG
TTCGCCTCCGGCAAGGCCGCCGACCCGCCGTCGTATCCCGCCCCGAACCCCGGCATGATG
CCGGCGCCAAGGAAGAAGGAGCTCGGGGGCTCAAACTCCAACTCCAACAAGGAGCTACAC
ATGTTCGTGTGGAGCTCTAGCGCGTCGCCGGTGTCGGAGGCCAACCTCCGCAACGCCGTC
AACCACGCCGCCTCCACCGACTTCGCCTCCGCGCCGCCGCCGGCAGCCGTTCCCGTCGGC
GGCGCCACTCCCAAAGGGGTGAGTGGCAGTGTCACGCCGGCGGCGAAGAACGGCGGCGGC
GAGTTGGAGATCGAGGACGGGCTGAAGAGCCCGGCGGCGGGGCTGGCGGCGAAGTTCCCG
GTGTCGGGGTCGCCGTACGTGGCGCCGAGGAAGAAGGGCGGCGGCGCCGACGTGCCCGGG
CTGGCGGAGGCGGCGCACCCGATGCCGCCGACGAGCGTGATGACGCGGCTCATCCTCATC
ATGGTGTGGCGCAAGCTCATCAGAAACCCCAACACCTACTCCAGCCTCATCGGCCTCGTC
TGGTCCCTCGTCTCCTTCAgGTGGAATATCCAAATGCCTTCAATAATAAAGGGCTCAATA
TCAATATTGTCAGATGCAGGGCTAGGAATGGCTATGTTCAGCTTAGGCTTGTTCATGGCT
CTGCAACCAAAGATCATTTCTTGTGGCAAGACCGTTGCGACATTTGCAATGGCAGTGAGG
TTCTTGACTGGTCCAGCTGTTATTGCAGCTACTTCCATTGCCATTGGGCTCAGGGGAGTA
CTCTTGCATGTTGCCATTGTTCAGGCAGCACTTCCACAAGGCATTGTCCCGTTTGTGTTT
GCCAAGGAGTACAATTGCCATCCTCAAATACTTAGCACAGCGGTTATTTTTGGGATGCTC
ATCGCGCTTCCGATCACGATACTCTACTATGTGCTTCTTGGGATATAGTGTTCTTGAAGA
AGGCAAAAAAGAAAGAGTAGGGAAAAAAATAGGATTCTAGGTTTCTAGAGGAAAATGCAA
AAGAAATATGATATGGGCTTTCTTGAAGACCTGAAGAACTACCAGAGCTGAAGAATAGGG
AAATGAGATCAAGTAGGATCCTAGCTAGAGAGAAATGCAAAGGAAAGACACCCCTTGATT
ACAATTTTTTAATTTTTTCTGCAACTGTTTTGGCATCAAAGTAAAGGTTAGGGCCTTGAG
TATGAAGAGTTCAGCCGTTAATTTGACAAGTTGGGTTGGCGGTACTAAAGATTCC

CDS

1893 bp

>Os06t0660200-01 Auxin efflux transporter, Polar auxin transport, Control of canopy architecture
ATGATCACCGGACGCGACATCTACGACGTGCTGGCGGCGATCGTGCCGCTGTACGTGGCG
ATGTTCCTGGCGTACGGGTCGGTGCGGTGGTGGGGGATATTCAcgccggaccagtgctcc
ggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctcc
accaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctc
gtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggc
ggcgccgccgcgtcgctcGACTGGACCATCACCCTCTTCTCGCTGTCCACGCTGCCCAAC
ACGCTGGTCATGGGCATCCCGCTGCTCCGCGCCATGTACGGCGACTTCTCCGGCTCGCTC
ATGGTGCAGATCGTCGTGCTCCAGAGCGTCATCTGGTACACCCTCATGCTCTTCCTCTTC
GAGTACCGCGGCGCCAAGGCGCTCATCTCCGAGCAGTTCCCGCCGGACGTCGGCGCCAGC
ATCGCCTCGTTCCGCGTCGACTCCGACGTCGTCTCGCTCAACGGGAGGGAGGCGCTGCAG
GCGGACGCCGAGGTGGGGCGCGACGGCCGCGTCCACGTCGTCATCCGCCGCTCCGCCTCG
GCCTCCACCACGGGCGGCGGCGGCGGCGCGGCGCGCTCCGGCGTGTCCCGGGCGTACGGC
GCGTCCAACGCCATGACGCCGCGCGCCTCCAACCTCACCGGCGTGGAGATCTACTCGCTG
CAGACGTCGCGCGAGCCCACGCCGCGGGCGTCCAGCTTCAACCAGGCCGACTTCTACGCC
ATGTTCTCCGGCAGCAAGATGGCCAGCCAGATGGCTAGCCCCATGGCGCAGCACGGCGGC
GCCGGCGGCCGCGCCCAGGGCCTCGACGAGCAGGTCACCAACAAGTTCGCCTCCGGCAAG
GCCGCCGACCCGCCGTCGTATCCCGCCCCGAACCCCGGCATGATGCCGGCGCCAAGGAAG
AAGGAGCTCGGGGGCTCAAACTCCAACTCCAACAAGGAGCTACACATGTTCGTGTGGAGC
TCTAGCGCGTCGCCGGTGTCGGAGGCCAACCTCCGCAACGCCGTCAACCACGCCGCCTCC
ACCGACTTCGCCTCCGCGCCGCCGCCGGCAGCCGTTCCCGTCGGCGGCGCCACTCCCAAA
GGGGTGAGTGGCAGTGTCACGCCGGCGGCGAAGAACGGCGGCGGCGAGTTGGAGATCGAG
GACGGGCTGAAGAGCCCGGCGGCGGGGCTGGCGGCGAAGTTCCCGGTGTCGGGGTCGCCG
TACGTGGCGCCGAGGAAGAAGGGCGGCGGCGCCGACGTGCCCGGGCTGGCGGAGGCGGCG
CACCCGATGCCGCCGACGAGCGTGATGACGCGGCTCATCCTCATCATGGTGTGGCGCAAG
CTCATCAGAAACCCCAACACCTACTCCAGCCTCATCGGCCTCGTCTGGTCCCTCGTCTCC
TTCAgGTGGAATATCCAAATGCCTTCAATAATAAAGGGCTCAATATCAATATTGTCAGAT
GCAGGGCTAGGAATGGCTATGTTCAGCTTAGGCTTGTTCATGGCTCTGCAACCAAAGATC
ATTTCTTGTGGCAAGACCGTTGCGACATTTGCAATGGCAGTGAGGTTCTTGACTGGTCCA
GCTGTTATTGCAGCTACTTCCATTGCCATTGGGCTCAGGGGAGTACTCTTGCATGTTGCC
ATTGTTCAGGCAGCACTTCCACAAGGCATTGTCCCGTTTGTGTTTGCCAAGGAGTACAAT
TGCCATCCTCAAATACTTAGCACAGCGGTTATTTTTGGGATGCTCATCGCGCTTCCGATC
ACGATACTCTACTATGTGCTTCTTGGGATATAG

Protein

631 aa

>Os06t0660200-01 Auxin efflux transporter, Polar auxin transport, Control of canopy architecture
MITGRDIYDVLAAIVPLYVAMFLAYGSVRWWGIFTPDQCSGINRFVAVFAVPLLSFHFIS
TNDPYSMNYRFLAADSLQKLVILAALAVWHNLLSRYRRNGGAAASLDWTITLFSLSTLPN
TLVMGIPLLRAMYGDFSGSLMVQIVVLQSVIWYTLMLFLFEYRGAKALISEQFPPDVGAS
IASFRVDSDVVSLNGREALQADAEVGRDGRVHVVIRRSASASTTGGGGGAARSGVSRAYG
ASNAMTPRASNLTGVEIYSLQTSREPTPRASSFNQADFYAMFSGSKMASQMASPMAQHGG
AGGRAQGLDEQVTNKFASGKAADPPSYPAPNPGMMPAPRKKELGGSNSNSNKELHMFVWS
SSASPVSEANLRNAVNHAASTDFASAPPPAAVPVGGATPKGVSGSVTPAAKNGGGELEIE
DGLKSPAAGLAAKFPVSGSPYVAPRKKGGGADVPGLAEAAHPMPPTSVMTRLILIMVWRK
LIRNPNTYSSLIGLVWSLVSFRWNIQMPSIIKGSISILSDAGLGMAMFSLGLFMALQPKI
ISCGKTVATFAMAVRFLTGPAVIAATSIAIGLRGVLLHVAIVQAALPQGIVPFVFAKEYN
CHPQILSTAVIFGMLIALPITILYYVLLGI*

5'UTR

chr06:27200808..27200882 (+ strand) : 75 bp

CDS

chr06:27200883..27201898 (+ strand) : 1016 bp

chr06:27201993..27202177 (+ strand) : 185 bp

chr06:27202266..27202569 (+ strand) : 304 bp

chr06:27203608..27203693 (+ strand) : 86 bp

chr06:27203793..27203950 (+ strand) : 158 bp

chr06:27204072..27204148 (+ strand) : 77 bp

chr06:27204238..27204304 (+ strand) : 67 bp

3'UTR

chr06:27204305..27204611 (+ strand) : 307 bp

FASTA

>Os06t0660200-01 class=Sequence position=chr06:27200808..27204611 (+ strand)
AATTAGCTCG TTCTCTTGTG TCAAGAAAAA AAAAGAAAGA AAAAGCTCGC CGCCGCCGCC ACCGTCGCCG GCGCGATGAT
CACCGGACGC GACATCTACG ACGTGCTGGC GGCGATCGTG CCGCTGTACG TGGCGATGTT CCTGGCGTAC GGGTCGGTGC
GGTGGTGGGG GATATTCAcg ccggaccagt gctccggcat caaccgcttc gtcgccgtct tcgccgtgcc gctcctctcc
ttccacttca tctccaccaa cgacccctac tccatgaact accgcttcct cgccgccgac tcgctccaga agctcgtcat
cctcgccgcg ctcgccgtct ggcacaacct gctctcccgc taccgccgca atggcggcgc cgccgcgtcg ctcGACTGGA
CCATCACCCT CTTCTCGCTG TCCACGCTGC CCAACACGCT GGTCATGGGC ATCCCGCTGC TCCGCGCCAT GTACGGCGAC
TTCTCCGGCT CGCTCATGGT GCAGATCGTC GTGCTCCAGA GCGTCATCTG GTACACCCTC ATGCTCTTCC TCTTCGAGTA
CCGCGGCGCC AAGGCGCTCA TCTCCGAGCA GTTCCCGCCG GACGTCGGCG CCAGCATCGC CTCGTTCCGC GTCGACTCCG
ACGTCGTCTC GCTCAACGGG AGGGAGGCGC TGCAGGCGGA CGCCGAGGTG GGGCGCGACG GCCGCGTCCA CGTCGTCATC
CGCCGCTCCG CCTCGGCCTC CACCACGGGC GGCGGCGGCG GCGCGGCGCG CTCCGGCGTG TCCCGGGCGT ACGGCGCGTC
CAACGCCATG ACGCCGCGCG CCTCCAACCT CACCGGCGTG GAGATCTACT CGCTGCAGAC GTCGCGCGAG CCCACGCCGC
GGGCGTCCAG CTTCAACCAG GCCGACTTCT ACGCCATGTT CTCCGGCAGC AAGATGGCCA GCCAGATGGC TAGCCCCATG
GCGCAGCACG GCGGCGCCGG CGGCCGCGCC CAGGGCCTCG ACGAGCAGGT CACCAACAAG TTCGCCTCCG GCAAGGCCGC
CGACCCGCCG TCGTATCCCG CCCCGAACCC CGGCATGATG CCGGCGCCAA GGTAAAATGA AACTGATTAT TAACACCTCA
AAATTTCTGT TCATCGATCG TGTTTTGATC GAGTTGGATT TTTGATTTTG TCGCCATTGC TACAGGAAGA AGGAGCTCGG
GGGCTCAAAC TCCAACTCCA ACAAGGAGCT ACACATGTTC GTGTGGAGCT CTAGCGCGTC GCCGGTGTCG GAGGCCAACC
TCCGCAACGC CGTCAACCAC GCCGCCTCCA CCGACTTCGC CTCCGCGCCG CCGCCGGCAG CCGTTCCCGT CGGCGGCGCC
ACTCCCAAAG GTACTCTCTC ATCCATCCAT TGACGCACAC GACGACGATC ACACCACATG TGTTCAAGGC TTCGTCTAAT
GGTGCGTGCA TGCCACAGGG GTGAGTGGCA GTGTCACGCC GGCGGCGAAG AACGGCGGCG GCGAGTTGGA GATCGAGGAC
GGGCTGAAGA GCCCGGCGGC GGGGCTGGCG GCGAAGTTCC CGGTGTCGGG GTCGCCGTAC GTGGCGCCGA GGAAGAAGGG
CGGCGGCGCC GACGTGCCCG GGCTGGCGGA GGCGGCGCAC CCGATGCCGC CGACGAGCGT GATGACGCGG CTCATCCTCA
TCATGGTGTG GCGCAAGCTC ATCAGAAACC CCAACACCTA CTCCAGCCTC ATCGGCCTCG TCTGGTCCCT CGTCTCCTTC
Aggtattgga ttctcaccga tgttttcggt actcaagctg acgttctcgc ttccacagtt ccacttcatc gacgcccgct
ttcccggtcg cttccctcta agatggaaca ctcttctgcc aatacatttt gacatcccac agctatgaca gatcgcttat
cccggttcat cttcagggca agggcgctTT TTTTCAAGtt ataccgaatt atcaaaacag attatttact ctccatttca
aaaaagtatt ttataaaaaa aaatattctt ctactacatt acttagatta cttgttttaa gctagttgtt aagttttttt
ttaaattgtt taatttattt gtataatgaa atcgataatc tgcatagtaa tcTAAACCAA ATAAGTAATA TACACTTGAG
TTCACGATCT GATCAATTTA TGTTGTTCGA AGCTACAAAA AGGATATATT TTTGCTATGC TATTCGTTGC TAGATTGCTT
GAAATTTTAA TCTAGGAAGA GGCAAGATCG ATGAGAACTT ACTTAACTTC ACAACTGGAT TAGTGTTTTC TGAACGCATG
TGAGAGCACA TGATAATTAC GTTGGTCTCG GATCTGGTCC AGCACATGCA AAGAACATAC ACACGTATGC AGATGCAGGT
GCAGGTGCAG GTCTTATGTG AGCCCTGGAG TTTAGCAGCA GAGACCAAAT CTACCGAATC AGCTGCGATT GCCGTGTTTG
TCCCCATCCA AGACAGACAC GGCGAATTCG GCTCAACTAG CTAGATGATC CATCATGTGT ACAAGAAGAA GAGCAAAAAA
TGTACAATGA TATGGATGCA TCATTGATTC ATTGTACTAC TATCTTACCA TTAGATGGCA CATCTAGAGG GAGGGTTGCA
AGAACAGGGC ATTTTTAGTG GGGAGGAGCA CATGCCTGCA AGCATCTAAA ATTGCATACA TGCATGATAC ATCTAGCATT
GATTCTCTTG TCATACAATT TTTTTTTACA TTGTGAAAAT ATATGCTTAA TTGCTTATTG ACTTTGTGAA TTTGGATCAG
GTGGAATATC CAAATGCCTT CAATAATAAA GGGCTCAATA TCAATATTGT CAGATGCAGG GCTAGGAATG GCTATGTTCA
GCTTAGGTAC AGAGTTGACC TTTTTGATAC ATATCTATAG CCATAACTAG TGAGTTTTTT CTTTGCTTTG ACCAAGAAAT
TCTGACAATA GTATATGTAA CCCAGGCTTG TTCATGGCTC TGCAACCAAA GATCATTTCT TGTGGCAAGA CCGTTGCGAC
ATTTGCAATG GCAGTGAGGT TCTTGACTGG TCCAGCTGTT ATTGCAGCTA CTTCCATTGC CATTGGGCTC AGGGGAGTAC
TCTTGCATGT TGCCATTGTT CAGGTAAGCA GTAGATTCTT TATTTCTTGC AATCATCTTA AAAGAAAAAA AATATTAAAT
TTTGTAATTA TGGTGAATTG GAATGTATTG TGGTGATCTT ATAGATTAAT TGATTGTCAA ACAGGCAGCA CTTCCACAAG
GCATTGTCCC GTTTGTGTTT GCCAAGGAGT ACAATTGCCA TCCTCAAATA CTTAGCACAG CGTAAGAAAT GCATGCTTAA
ACTTTCTATT TGTTCGTCCA TACGGTTGCT GAAGTATATA GCCTAAAATA TATAAATGTG AAATTTTCAG GGTTATTTTT
GGGATGCTCA TCGCGCTTCC GATCACGATA CTCTACTATG TGCTTCTTGG GATATAGTGT TCTTGAAGAA GGCAAAAAAG
AAAGAGTAGG GAAAAAAATA GGATTCTAGG TTTCTAGAGG AAAATGCAAA AGAAATATGA TATGGGCTTT CTTGAAGACC
TGAAGAACTA CCAGAGCTGA AGAATAGGGA AATGAGATCA AGTAGGATCC TAGCTAGAGA GAAATGCAAA GGAAAGACAC
CCCTTGATTA CAATTTTTTA ATTTTTTCTG CAACTGTTTT GGCATCAAAG TAAAGGTTAG GGCCTTGAGT ATGAAGAGTT
CAGCCGTTAA TTTGACAAGT TGGGTTGGCG GTACTAAAGA TTCC

Locus: Os06g0660200

Loading...

Locus: Os06g0660200

Loading...