Os06t0662200-01

Locus

Os06g0662200

Description

Basic leucine zipper (bZIP) transcription factor, Negative regulator of cold and drought stress response

RAP-DB Gene Symbol Synonym(s)

OsbZIP52, OsbZIP52/RISBZ5, RISBZ5

RAP-DB Gene Name Synonym(s)

RICE SEED B-ZIPPER 5, b-ZIP transcription factor 52, rice seed b-Zipper 5

CGSNL Gene Symbol

RISBZ5

CGSNL Gene Name

RICE SEED B-ZIPPER 5

Oryzabase Gene Symbol Synonym(s)

OsbZIP52

Oryzabase Gene Name Synonym(s)

b-ZIP transcription factor 52, rice seed b-Zipper 5

Transcript Evidence

AK065941

Protein Evidence

Q654B3

Literature

PMID: 22189955

Note

Manual Curation

April 25, 2017

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

Basic-leucine zipper domain (IPR004827)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013049M10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0662200-01)

RiceXPro (AK065941)

Others

Oryzabase (10135)

KEGG (Os06t0662200-01)

Transcript

1601 bp

>Os06t0662200-01 Basic leucine zipper (bZIP) transcription factor, Negative regulator of cold and drought stress response
GGTCGGAGGAAGGCGATGATGAAGAAGTGCCCGTCGGAGCTGCAGCTGGAGGCGTTCATC
CGGGAGGAGGCCGGCGCCGGCGACCGCAAGCCCGGCGTGTTATCTCCCGGCGACGGCGCG
CGTAAGTCCGGCCTGTTCTCTCCCGGCGACGGCGAGATGTCCGTGTTGGATCAGAGTACA
CTGGACGGAAGCGGCGGCGGCCACCAGCTGTGGTGGCCGGAGAGCGTCCGTACGCCGCCG
CGCGCCGCCGCCGCCTTCTCGGCCACGGCCGACGAGCGGACGCCGGCGTCCATCTCCGAT
GACCCCAAACCAACCACCTCAGCGAACCACGCGCCTGAAAGCGACTCGGACTCCGATTGC
GATTCGCTGTTAGAAGCAGAGAGGAGTCCACGCCTGCGTGGCACGAAATCCACAGAAACA
AAGCGAATAAGAAGGATGGTGTCCAACAGGGAGTCCGCTCGACGATCCAGGAGGAGAAAG
CAGGCACAGTTATCTGAACTCGAATCACAGGTCGAGCAACTCAAAGGCGAAAACTCATCC
CTCTTCAAGCAGCTCACAGAGTCCAGCCAGCAGTTCAATACAGCGGTCACGGACAACAGG
ATCCTCAAATCGGATGTAGAGGCCTTAAGAGTCAAGGTCAAGATGGCTGAAGACATGGTC
GCGAGGGCCGCGATGTCGTGTGGCCTGGGCCAGCTCGGGCTGGCGCCATTGCTCAGCTCC
AGGAAGATGTGCCAAGCTTTGGATATGCTCAGTTTACCACGGAACGATGCCTGTGGTTTC
AAAGGCTTGAACCTGGGTCGACAGGTTCAGAACTCACCGGTTCAAAGCGCTGCAAGCCTA
GAGAGCCTGGACAACCGGATATCCAGCGAGGTGACCAGCTGCTCGGCTGATGTGTGGCCT
TAAGACACTTCATCCGTGTTCGAGAGAGCTTGAGATTCTAAGAAGCAGCCGGTGAGAATC
TGAAAAGGCTAGTTGTTCAGTTTCCTATTTTTAGTTTATGTTTGAATTCTCTGGCTACTA
ATGCTCAAAATCTGGGAGAGAATCTAAATCGTTTGGGACAGATAAAAAATTATGCGAGAA
GGTGTAGCTGACAGAAACCTTCCCAAACAAATCTCCATCAGAACCTATATGTAAAGTAAT
ACGGTATCCTCTGTTACTAGGTGCATGTGCATAACTGACAAGCTGCTAAGTACTAGGTAC
TACAGTCTGAGGCAAGTATTTCTGGTGTTTTGGTGCTGAAGAACTATGTTTTAGTGCGTT
TGATCTGCGGCAATCAAGGCCATCTGATCGAAATTTGATTGGTATAAATCTGATCGAAAT
TTGATTGGTATAAGTATAATAGTTTGATTTTGATCACCTCTAGTCGTCAGCGCCTTTGGT
GTATACGCTCTGTAACATCTGTTACGAATTGATCTGTTCAGTATACTTCAACAGTCCTGC
ATTGGTTCAGTTCTTGGCGTAGCTCTGGTGCTTCTGGTGCGCATAGCATCGGTGTGAAAT
GTGCCACTTTTCATGGCAGTTGTAATAGTAAACGACTGCAAAATTACGGTGTACTATAAT
TCCTAAACAAATATGTGACAATTACGATGAAAATTATCACT

CDS

888 bp

>Os06t0662200-01 Basic leucine zipper (bZIP) transcription factor, Negative regulator of cold and drought stress response
ATGATGAAGAAGTGCCCGTCGGAGCTGCAGCTGGAGGCGTTCATCCGGGAGGAGGCCGGC
GCCGGCGACCGCAAGCCCGGCGTGTTATCTCCCGGCGACGGCGCGCGTAAGTCCGGCCTG
TTCTCTCCCGGCGACGGCGAGATGTCCGTGTTGGATCAGAGTACACTGGACGGAAGCGGC
GGCGGCCACCAGCTGTGGTGGCCGGAGAGCGTCCGTACGCCGCCGCGCGCCGCCGCCGCC
TTCTCGGCCACGGCCGACGAGCGGACGCCGGCGTCCATCTCCGATGACCCCAAACCAACC
ACCTCAGCGAACCACGCGCCTGAAAGCGACTCGGACTCCGATTGCGATTCGCTGTTAGAA
GCAGAGAGGAGTCCACGCCTGCGTGGCACGAAATCCACAGAAACAAAGCGAATAAGAAGG
ATGGTGTCCAACAGGGAGTCCGCTCGACGATCCAGGAGGAGAAAGCAGGCACAGTTATCT
GAACTCGAATCACAGGTCGAGCAACTCAAAGGCGAAAACTCATCCCTCTTCAAGCAGCTC
ACAGAGTCCAGCCAGCAGTTCAATACAGCGGTCACGGACAACAGGATCCTCAAATCGGAT
GTAGAGGCCTTAAGAGTCAAGGTCAAGATGGCTGAAGACATGGTCGCGAGGGCCGCGATG
TCGTGTGGCCTGGGCCAGCTCGGGCTGGCGCCATTGCTCAGCTCCAGGAAGATGTGCCAA
GCTTTGGATATGCTCAGTTTACCACGGAACGATGCCTGTGGTTTCAAAGGCTTGAACCTG
GGTCGACAGGTTCAGAACTCACCGGTTCAAAGCGCTGCAAGCCTAGAGAGCCTGGACAAC
CGGATATCCAGCGAGGTGACCAGCTGCTCGGCTGATGTGTGGCCTTAA

Protein

296 aa

>Os06t0662200-01 Basic leucine zipper (bZIP) transcription factor, Negative regulator of cold and drought stress response
MMKKCPSELQLEAFIREEAGAGDRKPGVLSPGDGARKSGLFSPGDGEMSVLDQSTLDGSG
GGHQLWWPESVRTPPRAAAAFSATADERTPASISDDPKPTTSANHAPESDSDSDCDSLLE
AERSPRLRGTKSTETKRIRRMVSNRESARRSRRRKQAQLSELESQVEQLKGENSSLFKQL
TESSQQFNTAVTDNRILKSDVEALRVKVKMAEDMVARAAMSCGLGQLGLAPLLSSRKMCQ
ALDMLSLPRNDACGFKGLNLGRQVQNSPVQSAASLESLDNRISSEVTSCSADVWP*

5'UTR

chr06:27302090..27302104 (- strand) : 15 bp

CDS

chr06:27301807..27302089 (- strand) : 283 bp

chr06:27301527..27301662 (- strand) : 136 bp

chr06:27301360..27301435 (- strand) : 76 bp

chr06:27301151..27301276 (- strand) : 126 bp

chr06:27300630..27300896 (- strand) : 267 bp

3'UTR

chr06:27299932..27300629 (- strand) : 698 bp

FASTA

>Os06t0662200-01 class=Sequence position=chr06:27299932..27302104 (- strand)
GGTCGGAGGA AGGCGATGAT GAAGAAGTGC CCGTCGGAGC TGCAGCTGGA GGCGTTCATC CGGGAGGAGG CCGGCGCCGG
CGACCGCAAG CCCGGCGTGT TATCTCCCGG CGACGGCGCG CGTAAGTCCG GCCTGTTCTC TCCCGGCGAC GGCGAGATGT
CCGTGTTGGA TCAGAGTACA CTGGACGGAA GCGGCGGCGG CCACCAGCTG TGGTGGCCGG AGAGCGTCCG TACGCCGCCG
CGCGCCGCCG CCGCCTTCTC GGCCACGGCC GACGAGCGGA CGCCGGCGTC CATCTCCGGT AGGTACACAT GACATAATTT
GAGTTTTTTT GAGTTACAGA GCTATTGTGC AAACAGCCCA TTTTCTATGC GTTTATTTGG AGTTATGAAA CACACCCAAA
TTTAGTCAAA TTCATCACAT GTTGGGTTCA TTTTGGTTGC AGATGACCCC AAACCAACCA CCTCAGCGAA CCACGCGCCT
GAAAGCGACT CGGACTCCGA TTGCGATTCG CTGTTAGAAG CAGAGAGGAG TCCACGCCTG CGTGGCACGA AATCCACAGA
AACAAAGCGA ATAAGAAGGT ACATAGTGAT CGATCAATCT TGATTTCTAG CAAATGCAAC AAATTTGAAC AGAGAACGCA
TTCTTATGAA CTGCTTGTTC GAATTTCAGG ATGGTGTCCA ACAGGGAGTC CGCTCGACGA TCCAGGAGGA GAAAGCAGGC
ACAGTTATCT GAACTCGAAT CACAGGTATT ATAAACTTCA AAGTTCAAAT TTCCAGATGC GTTGATGCAA ATATCAGTGT
GATCTTACAG CAATCCATCT ATGATCAGGT CGAGCAACTC AAAGGCGAAA ACTCATCCCT CTTCAAGCAG CTCACAGAGT
CCAGCCAGCA GTTCAATACA GCGGTCACGG ACAACAGGAT CCTCAAATCG GATGTAGAGG CCTTAAGAGT CAAGGTAATT
AGAAACCAAA CTCTCCTTCA GCCACCAATT ATcggcgcat ttaacttttc gccactttta agatgaggta attaagaatt
taccacccat agtctatgac aacatatggg tctttatcac tttatgtgtc tatgacatgt gagtccaatt gcaaattgtc
actcgtaaga gtggtaaata gttaattgtt TCTGATGATC GGCTTCCGGC ATCTCTCCAA ACTTACCAAT TCTTGGCTTC
GATCCCAGGT CAAGATGGCT GAAGACATGG TCGCGAGGGC CGCGATGTCG TGTGGCCTGG GCCAGCTCGG GCTGGCGCCA
TTGCTCAGCT CCAGGAAGAT GTGCCAAGCT TTGGATATGC TCAGTTTACC ACGGAACGAT GCCTGTGGTT TCAAAGGCTT
GAACCTGGGT CGACAGGTTC AGAACTCACC GGTTCAAAGC GCTGCAAGCC TAGAGAGCCT GGACAACCGG ATATCCAGCG
AGGTGACCAG CTGCTCGGCT GATGTGTGGC CTTAAGACAC TTCATCCGTG TTCGAGAGAG CTTGAGATTC TAAGAAGCAG
CCGGTGAGAA TCTGAAAAGG CTAGTTGTTC AGTTTCCTAT TTTTAGTTTA TGTTTGAATT CTCTGGCTAC TAATGCTCAA
AATCTGGGAG AGAATCTAAA TCGTTTGGGA CAGATAAAAA ATTATGCGAG AAGGTGTAGC TGACAGAAAC CTTCCCAAAC
AAATCTCCAT CAGAACCTAT ATGTAAAGTA ATACGGTATC CTCTGTTACT AGGTGCATGT GCATAACTGA CAAGCTGCTA
AGTACTAGGT ACTACAGTCT GAGGCAAGTA TTTCTGGTGT TTTGGTGCTG AAGAACTATG TTTTAGTGCG TTTGATCTGC
GGCAATCAAG GCCATCTGAT CGAAATTTGA TTGGTATAAA TCTGATCGAA ATTTGATTGG TATAAGTATA ATAGTTTGAT
TTTGATCACC TCTAGTCGTC AGCGCCTTTG GTGTATACGC TCTGTAACAT CTGTTACGAA TTGATCTGTT CAGTATACTT
CAACAGTCCT GCATTGGTTC AGTTCTTGGC GTAGCTCTGG TGCTTCTGGT GCGCATAGCA TCGGTGTGAA ATGTGCCACT
TTTCATGGCA GTTGTAATAG TAAACGACTG CAAAATTACG GTGTACTATA ATTCCTAAAC AAATATGTGA CAATTACGAT
GAAAATTATC ACT

Locus: Os06g0662200

Loading...

Locus: Os06g0662200

Loading...