Os06t0665400-01

Locus

Os06g0665400

Description

F-box protein, Inflorescence form, Lodging resistance and grain yield

RAP-DB Gene Symbol Synonym(s)

APO1, apo1(t), apo1, SCM2, SCM2/APO1, OsFbox321, Os_F0393

RAP-DB Gene Name Synonym(s)

ABERRANT PANICLE ORGANIZATION 1, aberrant panicle organization 1, aberrant panicle organization-1, STRONG CULM 2, STRONG CULM2, F-box protein 321

CGSNL Gene Symbol

APO1

CGSNL Gene Name

ABERRANT PANICLE ORGANIZATION 1

Oryzabase Gene Symbol Synonym(s)

apo1(t), apo1, SCM2, SCM2/APO1, OsFbox321, Os_F0393

Oryzabase Gene Name Synonym(s)

aberrant panicle organization 1, aberrant panicle organization-1, STRONG CULM 2, STRONG CULM2, F-box protein 321

Transcript Evidence

AB292777 (DDBJ)

Protein Evidence

Q655Y0 (UniProt)

Literature

PMID: 17666027

PMID: 19386809

PMID: 21119645

Note

Manual Curation

July 17, 2009

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box domain, cyclin-like (IPR001810)

Galactose oxidase/kelch, beta-propeller (IPR011043)

Galactose oxidase, beta-propeller (IPR015916)

Expression Databases

TENOR (Os06t0665400-01)

Others

Oryzabase (2123)

Transcript

1290 bp

>Os06t0665400-01 F-box protein, Inflorescence form, Lodging resistance and grain yield
ATGATGAACCCTCGCCGGCTGCCGCCTCTGCCGTCGTCGACGTCGTCCGCCTCGGCAGCG
GACGACATGGACCCGCGCGTGTGGCGCCGGCTGCCGCAGCCGCTGGTGGACCGCATCCTG
GCGTGCCTCCCGACGCCGTCGTTCCTCCGCCTCCGCGCCGCCTGCCGCCGCTTCTACCAC
CTCCTCTTCTCCTCCCCGTTCCTCCACTCCCACCTCCTCCTCTCCCCTCACCTCCCCTTC
TTCGCCTTCGTCGTCCCCGCCGCCGGCCACCTCCTCCTCCTCGACCCCACCGCCACCGCC
TCCTGGTCCCGCCTCCCGCTCCCGCTCCCGCCCGTCGCCGGCGGCCCCGCCGCGTTCTCG
CCCGCGGCCGCGTCCGCCGGCCTGCTCGCGTTCCTGTCCGACGCGTCGGGGCACAAGACG
CTGCTGCTCGCCAACCCGATCACCCGCCTCCTCGCCGCGCTCCCCATCTCCCCGACCCCG
CGCCTCTCCCCCACCGTCGGCCTCGCCGCCGGCCCGACCTCCATCATCGCCGTCGTGGCC
GGGGACGACCTCGTGTCCCCCTTCGCCGTCAAGAACATCTCCGCCGACACGTTCGTCGCC
GACGCCGCCTCCGTCCCGCCCTCCGGCTTCTGGGCTCCCAGCTCCCTGCTCCCTCGCCTC
TCCTCCCTCGATCCCCGCGCCGGCATGGCCTTCGCCTCCGGCAGGTTCTACTGCATGAGC
TCGTCGCCGTTTGCGGTTCTGGTGTTCGACGTGGCGGAGAACGTATGGAGCAAGGTGCAG
CCGCCGATGAGGCGGTTCCTGAGGTCGCCGGCGCTGGTGGAGCTCGGCGGCGGGAGGGAG
GGAGCGGCGAGGGTGGCGCTGGTGTCGGCCGTCGAGAAGAGCCGTCTCAGCGTGCCCCGC
AGCGTGCGCCTGTGGACGCTGCGCGGCGGCGGCGGCGGCGGCGGCGGTGGCGCGTGGACG
GAGGTGGCGCGGATGCCGCCGGAGGTGCACGCGCAGTTCGCCGCGGCGGAGGGCGGGCGC
GGGTTCGAGTGCGCGGCGCACGGCGACTACGTCGTGCTCGCGCCGCGCGGGCCCGTGGCG
CAGGCGCCCACGAGCGCGCTCGTGTTCGACTCCCGCCGCGACGAGTGGCGGTGGGCGCCG
CCGTGCCCGTACGTCGTCGTCGCGCACCACGGCGGCGCCGGCGCGGCGGGTTTCCGGGTG
TTCGCGTACGAGCCCCGGCTGGCGACGCCGGCCATTGGCCTCCTCGACGCCACGGCGCCC
GTCGCCTTGCATGGCATGCATGATGGTTAG

CDS

1290 bp

>Os06t0665400-01 F-box protein, Inflorescence form, Lodging resistance and grain yield
ATGATGAACCCTCGCCGGCTGCCGCCTCTGCCGTCGTCGACGTCGTCCGCCTCGGCAGCG
GACGACATGGACCCGCGCGTGTGGCGCCGGCTGCCGCAGCCGCTGGTGGACCGCATCCTG
GCGTGCCTCCCGACGCCGTCGTTCCTCCGCCTCCGCGCCGCCTGCCGCCGCTTCTACCAC
CTCCTCTTCTCCTCCCCGTTCCTCCACTCCCACCTCCTCCTCTCCCCTCACCTCCCCTTC
TTCGCCTTCGTCGTCCCCGCCGCCGGCCACCTCCTCCTCCTCGACCCCACCGCCACCGCC
TCCTGGTCCCGCCTCCCGCTCCCGCTCCCGCCCGTCGCCGGCGGCCCCGCCGCGTTCTCG
CCCGCGGCCGCGTCCGCCGGCCTGCTCGCGTTCCTGTCCGACGCGTCGGGGCACAAGACG
CTGCTGCTCGCCAACCCGATCACCCGCCTCCTCGCCGCGCTCCCCATCTCCCCGACCCCG
CGCCTCTCCCCCACCGTCGGCCTCGCCGCCGGCCCGACCTCCATCATCGCCGTCGTGGCC
GGGGACGACCTCGTGTCCCCCTTCGCCGTCAAGAACATCTCCGCCGACACGTTCGTCGCC
GACGCCGCCTCCGTCCCGCCCTCCGGCTTCTGGGCTCCCAGCTCCCTGCTCCCTCGCCTC
TCCTCCCTCGATCCCCGCGCCGGCATGGCCTTCGCCTCCGGCAGGTTCTACTGCATGAGC
TCGTCGCCGTTTGCGGTTCTGGTGTTCGACGTGGCGGAGAACGTATGGAGCAAGGTGCAG
CCGCCGATGAGGCGGTTCCTGAGGTCGCCGGCGCTGGTGGAGCTCGGCGGCGGGAGGGAG
GGAGCGGCGAGGGTGGCGCTGGTGTCGGCCGTCGAGAAGAGCCGTCTCAGCGTGCCCCGC
AGCGTGCGCCTGTGGACGCTGCGCGGCGGCGGCGGCGGCGGCGGCGGTGGCGCGTGGACG
GAGGTGGCGCGGATGCCGCCGGAGGTGCACGCGCAGTTCGCCGCGGCGGAGGGCGGGCGC
GGGTTCGAGTGCGCGGCGCACGGCGACTACGTCGTGCTCGCGCCGCGCGGGCCCGTGGCG
CAGGCGCCCACGAGCGCGCTCGTGTTCGACTCCCGCCGCGACGAGTGGCGGTGGGCGCCG
CCGTGCCCGTACGTCGTCGTCGCGCACCACGGCGGCGCCGGCGCGGCGGGTTTCCGGGTG
TTCGCGTACGAGCCCCGGCTGGCGACGCCGGCCATTGGCCTCCTCGACGCCACGGCGCCC
GTCGCCTTGCATGGCATGCATGATGGTTAG

Protein

430 aa

>Os06t0665400-01 F-box protein, Inflorescence form, Lodging resistance and grain yield
MMNPRRLPPLPSSTSSASAADDMDPRVWRRLPQPLVDRILACLPTPSFLRLRAACRRFYH
LLFSSPFLHSHLLLSPHLPFFAFVVPAAGHLLLLDPTATASWSRLPLPLPPVAGGPAAFS
PAAASAGLLAFLSDASGHKTLLLANPITRLLAALPISPTPRLSPTVGLAAGPTSIIAVVA
GDDLVSPFAVKNISADTFVADAASVPPSGFWAPSSLLPRLSSLDPRAGMAFASGRFYCMS
SSPFAVLVFDVAENVWSKVQPPMRRFLRSPALVELGGGREGAARVALVSAVEKSRLSVPR
SVRLWTLRGGGGGGGGGAWTEVARMPPEVHAQFAAAEGGRGFECAAHGDYVVLAPRGPVA
QAPTSALVFDSRRDEWRWAPPCPYVVVAHHGGAGAAGFRVFAYEPRLATPAIGLLDATAP
VALHGMHDG*

CDS

chr06:27480750..27481453 (- strand) : 704 bp

chr06:27480082..27480667 (- strand) : 586 bp

FASTA

>Os06t0665400-01 class=Sequence position=chr06:27480082..27481453 (- strand)
ATGATGAACC CTCGCCGGCT GCCGCCTCTG CCGTCGTCGA CGTCGTCCGC CTCGGCAGCG GACGACATGG ACCCGCGCGT
GTGGCGCCGG CTGCCGCAGC CGCTGGTGGA CCGCATCCTG GCGTGCCTCC CGACGCCGTC GTTCCTCCGC CTCCGCGCCG
CCTGCCGCCG CTTCTACCAC CTCCTCTTCT CCTCCCCGTT CCTCCACTCC CACCTCCTCC TCTCCCCTCA CCTCCCCTTC
TTCGCCTTCG TCGTCCCCGC CGCCGGCCAC CTCCTCCTCC TCGACCCCAC CGCCACCGCC TCCTGGTCCC GCCTCCCGCT
CCCGCTCCCG CCCGTCGCCG GCGGCCCCGC CGCGTTCTCG CCCGCGGCCG CGTCCGCCGG CCTGCTCGCG TTCCTGTCCG
ACGCGTCGGG GCACAAGACG CTGCTGCTCG CCAACCCGAT CACCCGCCTC CTCGCCGCGC TCCCCATCTC CCCGACCCCG
CGCCTCTCCC CCACCGTCGG CCTCGCCGCC GGCCCGACCT CCATCATCGC CGTCGTGGCC GGGGACGACC TCGTGTCCCC
CTTCGCCGTC AAGAACATCT CCGCCGACAC GTTCGTCGCC GACGCCGCCT CCGTCCCGCC CTCCGGCTTC TGGGCTCCCA
GCTCCCTGCT CCCTCGCCTC TCCTCCCTCG ATCCCCGCGC CGGCATGGCC TTCGCCTCCG GCAGGTAAGC GCGCCGCGCC
ATTGATGACG CATGGGTAAA TACTCTTGCA CAGATTTGCT GATCTTGCCT TGGTTGTTGT TCTTAGGTTC TACTGCATGA
GCTCGTCGCC GTTTGCGGTT CTGGTGTTCG ACGTGGCGGA GAACGTATGG AGCAAGGTGC AGCCGCCGAT GAGGCGGTTC
CTGAGGTCGC CGGCGCTGGT GGAGCTCGGC GGCGGGAGGG AGGGAGCGGC GAGGGTGGCG CTGGTGTCGG CCGTCGAGAA
GAGCCGTCTC AGCGTGCCCC GCAGCGTGCG CCTGTGGACG CTGCGCGGCG GCGGCGGCGG CGGCGGCGGT GGCGCGTGGA
CGGAGGTGGC GCGGATGCCG CCGGAGGTGC ACGCGCAGTT CGCCGCGGCG GAGGGCGGGC GCGGGTTCGA GTGCGCGGCG
CACGGCGACT ACGTCGTGCT CGCGCCGCGC GGGCCCGTGG CGCAGGCGCC CACGAGCGCG CTCGTGTTCG ACTCCCGCCG
CGACGAGTGG CGGTGGGCGC CGCCGTGCCC GTACGTCGTC GTCGCGCACC ACGGCGGCGC CGGCGCGGCG GGTTTCCGGG
TGTTCGCGTA CGAGCCCCGG CTGGCGACGC CGGCCATTGG CCTCCTCGAC GCCACGGCGC CCGTCGCCTT GCATGGCATG
CATGATGGTT AG