Os06t0667100-01

Locus

Os06g0667100

Description

Similar to Nuclear Y/CCAAT-box binding factor C subunit NF-YC.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5B

CGSNL Gene Name

HAP5B SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5B, NF-YC, CBF-C, OsNF-YC4, Os-NF-YC4, NF-YC4, NFYC4, OsNF-YC4-3, NF-YC4-3

Oryzabase Gene Name Synonym(s)

Nuclear factor Y C4 subunit, Nuclear factor Y C subunit 4, NUCLEAR FACTOR-Y subunit C4, NUCLEAR FACTOR-Y subunit NF-YC4, NF-YC subunit 4, NF-YC family 4

Transcript Evidence

AK105079 (DDBJ, Best hit)

AK066630 (DDBJ, Best hit)

Protein Evidence

NP_001149626.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

001-045-H09 (Online Clone Ordering)

J013068I17 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0667100-01)

Others

Oryzabase (8492)

Transcript

1418 bp

>Os06t0667100-01 Similar to Nuclear Y/CCAAT-box binding factor C subunit NF-YC.
CTTCCCCCACCTCCGCCTCTCTCTCGATCCATCTCCCCCCTCTCTCCTCTCCTCTCTCTC
TCCGTTCCCAATCTGCGGAGGCGGAGGCGGAGCTAGGGCGCGGCGTCGCCGGCGAGGAGT
TCCGCAGGCGCGGTGTGGACGGGGCTCCTCTGCTTCCGCACACGGCGGGCGGCGACGGCG
AGCAGGGTTGGAGGGGCGGCGCGGCGACCTCCTCGTTCCTGCCTTGCCTGCCTCCATCTG
GTGTTGGAAATATCATAAGTTTTGGGACAAGCAAGAGAGGACATGGAGCCATCATCACAA
CCTCAGCCGGCAATTGGTGTTGTTGCTGGTGGATCACAAGTGTACCCTGCATACCGGCCT
GCAGCAACAGTGCCTACAGCTCCTGCTGTCATTCCTGCCGGTTCACAGCCAGCACCGTCG
TTCCCTGCCAACCCTGATCAACTGAGTGCTCAGCACCAGCTCGTCTATCAGCAAGCCCAG
CAATTTCACCAGCAGCTTCAGCAGCAGCAACAGCGTCAACTCCAGCAGTTTTGGGCTGAA
CGTCTGGTCGATATTGAACAAACTACTGACTTCAAGAACCACAGCTTGCCACTTGCTAGG
ATAAAGAAGATCATGAAGGCAGATGAGGACGTTCGCATGATCTCCGCAGAGGCTCCTGTG
ATCTTTGCGAAAGCATGTGAGATATTCATACTGGAGCTGACCCTGAGATCATGGATGCAC
ACGGAGGAGAACAAGCGCCGTACCTTGCAGAAGAATGACATAGCAGCTGCCATCACCAGG
ACGGATATGTACGATTTCTTGGTAGATATAGTTCCCAGGGATGACTTGAAGGAGGAGGGA
GTTGGGCTCCCTAGGGCTGGATTGCCGCCCTTGGGTGTCCCTGCTGACTCATATCCGTAT
GGCTACTATGTGCCACAGCAGCAGGTCCCAGGTGCAGGAATAGCGTATGGTGGTCAGCAA
GGTCATCCGGGGTATCTGTGGCAGGATCCTCAGGAACAGCAGGAAGAGCCTCCTGCAGAG
CAGCAAAGTGATTAAGAAGAGTAAATGATCCCTGTGAATTGTCAAGAAGCTTACCACCTG
ATTCAGAATTTTACTTTTAGCCAGGTTGTCGTCTATTCTGAATTTATGAATAGGATTAGG
ATTCTCTCATGGTAGTTGCATTTCTGCTGTAGTGGAAAAGGATTTATGACATGAGAGTAT
GAGACTAATGGGTTTCAGTTACTATACCGTTTCCTGTCAATCCAAAAGTTGGCCTTTGCG
AGGCCATTGATATTGAACCTAATGTGGTTGAACTGCCCATGCCAACGTTTGTAAGCTCTG
ATGTGGGTCATTCTGTATTTCATGTTTGCATGGTTTCATGGAATCTTCTTTGTTTAGACA
ATGAAAATGTTTTACATTCGTGGCATCTGCCATAACAC

CDS

753 bp

>Os06t0667100-01 Similar to Nuclear Y/CCAAT-box binding factor C subunit NF-YC.
ATGGAGCCATCATCACAACCTCAGCCGGCAATTGGTGTTGTTGCTGGTGGATCACAAGTG
TACCCTGCATACCGGCCTGCAGCAACAGTGCCTACAGCTCCTGCTGTCATTCCTGCCGGT
TCACAGCCAGCACCGTCGTTCCCTGCCAACCCTGATCAACTGAGTGCTCAGCACCAGCTC
GTCTATCAGCAAGCCCAGCAATTTCACCAGCAGCTTCAGCAGCAGCAACAGCGTCAACTC
CAGCAGTTTTGGGCTGAACGTCTGGTCGATATTGAACAAACTACTGACTTCAAGAACCAC
AGCTTGCCACTTGCTAGGATAAAGAAGATCATGAAGGCAGATGAGGACGTTCGCATGATC
TCCGCAGAGGCTCCTGTGATCTTTGCGAAAGCATGTGAGATATTCATACTGGAGCTGACC
CTGAGATCATGGATGCACACGGAGGAGAACAAGCGCCGTACCTTGCAGAAGAATGACATA
GCAGCTGCCATCACCAGGACGGATATGTACGATTTCTTGGTAGATATAGTTCCCAGGGAT
GACTTGAAGGAGGAGGGAGTTGGGCTCCCTAGGGCTGGATTGCCGCCCTTGGGTGTCCCT
GCTGACTCATATCCGTATGGCTACTATGTGCCACAGCAGCAGGTCCCAGGTGCAGGAATA
GCGTATGGTGGTCAGCAAGGTCATCCGGGGTATCTGTGGCAGGATCCTCAGGAACAGCAG
GAAGAGCCTCCTGCAGAGCAGCAAAGTGATTAA

Protein

251 aa

>Os06t0667100-01 Similar to Nuclear Y/CCAAT-box binding factor C subunit NF-YC.
MEPSSQPQPAIGVVAGGSQVYPAYRPAATVPTAPAVIPAGSQPAPSFPANPDQLSAQHQL
VYQQAQQFHQQLQQQQQRQLQQFWAERLVDIEQTTDFKNHSLPLARIKKIMKADEDVRMI
SAEAPVIFAKACEIFILELTLRSWMHTEENKRRTLQKNDIAAAITRTDMYDFLVDIVPRD
DLKEEGVGLPRAGLPPLGVPADSYPYGYYVPQQQVPGAGIAYGGQQGHPGYLWQDPQEQQ
EEPPAEQQSD*

5'UTR

chr06:27627768..27628008 (+ strand) : 241 bp

chr06:27631861..27631901 (+ strand) : 41 bp

CDS

chr06:27631902..27632654 (+ strand) : 753 bp

3'UTR

chr06:27632655..27633037 (+ strand) : 383 bp

FASTA

>Os06t0667100-01 class=Sequence position=chr06:27627768..27633037 (+ strand)
CTTCCCCCAC CTCCGCCTCT CTCTCGATCC ATCTCCCCCC TCTCTCCTCT CCTCTCTCTC TCCGTTCCCA ATCTGCGGAG
GCGGAGGCGG AGCTAGGGCG CGGCGTCGCC GGCGAGGAGT TCCGCAGGCG CGGTGTGGAC GGGGCTCCTC TGCTTCCGCA
CACGGCGGGC GGCGACGGCG AGCAGGGTTG GAGGGGCGGC GCGGCGACCT CCTCGTTCCT GCCTTGCCTG CCTCCATCTG
GGTATGAATC GGACATCAGT TTTTGTGTTT CCGAAATTTC AAAAAATATA TGCATGTCGG GTTGGGGGGT TCAGCTCGCC
ACGTTGGGCA AAGCCGTCCG TGGTGGTGTA TAAGTTATTG CTTTCCACAT TTGTTAGGAA AAAAGTATGC GTGATTTAAT
CCGATGGTAG TTTGACTACT AAAAATAGTG GTCGTCTGAT AGCTGTGTCT CCTTGGTCAA ATTGGGGGTC AAATTGTTGG
GATCATTGTC GTTAATAAGT GATTGATCGG TCCAACAGTT AATCCGTTTG TGCTTTTGTT TGCTTGTACG GAATCTGAAT
CATGCATTCA CAAGTTTTTG TTATGGAAAA CAGTAGGGGG AAAAATCCTA TATGAAGTAT CTGTTTGTTG AACAGTAGGA
AATACGACCG TATAATTGTA TTGAAGATCT TGTGATTTTG AACTGCCCAA GTATGCCAAC AGTAGAGTTG GTAGTTTTGC
ATATACACCG AGTACTAATT TTGCAAGGCT AGTGTTTTCT CCCCTGTTCT GAGATTATAT CCATGATCCC ATGGCTTATC
TTCATCCATT CTGTGAAGAG CAATTGCTTC TTGTCTAGAA ACCTTTCTAC ATTTGCTATC TTGGTATGGA CAAACTTTTG
TTGTAGGAAC CTTAGGTTAT GTCTTTACTC GGTAATTGAA AGTTCACACA ATAATCCAGC ATTTTGATCA AATTAATTAG
ATCGTTCCAA CATACTTGAA TTTAGTGGCC AAACATAATT GTTTATATCG GTTATCTCAT GGCCACGTTG TTAAAAACCA
TAACAATCTC CATGTACCTC TTTTTCCATC AAAGTTCGTT GAGAGTTTAT ACATAAATCA GAAAATAGTA AATATGAGAT
TGTAATGGGA AGGAATTGTA GCTAGCGATA CACATTTATC CCTATAGGTG ATTTCTGCCC TAGTGTATTT TGTAGGTTAA
GAGAGTCGAT GGATTGTCTA CACTAGATTT GTACAAAGTT TTCTTCAGCT GTAATTCAAT TCAAGTCTAT AAGAACAGAA
CATGAATTAA ATTTTATTGA GAATAATGCC AAAATTGGCA TTGTTAGCAA AATCCTCTAA CTGGAAGTAA TCAAATAAAA
GTTTCTAATC TCAAGCCCTA CTACCCCCTA ACTCAGTAGG GACCCAACCC AACATTGCAA CCTCCAGCTG GACTAATTTT
CCTTGAAGAC AGGCTGATAA CTTAAGCTAG GCTGAAGAGT ACAAGGGCCT TGACACATTC ACTAGCCCAG TTTAATGATA
TTTTTTGGGC CTTGACATAT TCACTAGCCC AGTTTAATGA TATTTTTTGG GCCTTGACTG ACATAATTTT GAGCATACCT
AGCAGGCCAA ATCCTTGTGG GGCTTGGTCA GGTTGGGCCA CTTGTGTTAT ATCTGGTCCA TCGCTACATT CGTAACCTAG
CATAATTTAT TAGTTAGTTT CAGTTGTCGC TTGTCAGAAA AAATTGCTCA GGTCACAAGT CCCCTGTGAA CCAAAATGTT
TGAGTCACGA AATTGTCGAT GGCAAATTTT TATCCTCTGA AAAGGTCTAG AAAGTAACAA AAAAAGGAAG TGGACCCATA
TCTTTAATTA CTGCCATATC AATACCAAAT CATGCTTATC CGATAACTGC GACTTTCCCA TCATCGAGTT ATATATATAC
CCTTTTGTTG ATTGAGACTT GTATAAATTG AAAAGGAGAA ATTCAGGTGC ATAAGGAATC TACGTTGCAT GCATAAGACG
GTAAGTACTA GCTTGTTTGC CAACTTTCTA CTTAAATCCA GTTGTGCAAT AGCCTGGCTT TAGATAAGTT TAATGATTTG
GTCTAGCGAA ACTTGTTTCA GATGATCAGA TATATTTCTT GTAGTGTTTA TATCTGTGCG TGTGCGAAAT AAATGCATAG
ATCGAGGGGG GTGAGCAGTT CAATGTACAA TCAGGAACAT CCTTCAGATA TGAATTTGGC CTGTTTGATT AAAATTTTCT
GTTTCCTACA TACATTTGAC TTTGATTGCC TATCTAACAA ATATCACAAA TACCAAGGTT TTTAAAATTG TTAGCTAGTA
CTCAAGCAGT CACAGACCTA CTACTGATTA TATATTTGTA TGCCCTAACT CGCCTGATTG TGTAGCATAA CTGGAAATCT
AGAACTATAC TGTAATAGTT GCCTTATTTA TGACCTACTA GATCTGTTCT TCCTTTGTAG TACACTGAGG AATATATACC
TCCTACATGT ATTAGATGTT ATTAGCAGCG TGTACTGAAA TAGCCCCCAC GTGATCTATT AGATGTGTTA ACACTTTGGA
ATCCTTAGTC TTGACAGCCT TGTGCTACAA GTATTGTGCC TGAAGGAGAT ACGGGTATGT ATGTGGATTG TGATTAGTCC
TATTGAATCT ATGCATAGAA GAGAGACCAT CAATACTATT TAAAAAGAGG AATTGGTTCT GGTTCTATGC ATGATCAGAT
TTTTCATTAA TGGGTTTAGA ATAGACCATC TACACATGTg ctgtttatag gatttttttt gtgtaaaata ttgcattctt
tcactgttgc atatgcatat attagttatc ggttgatctt gcattattat atgtatacaa ttatttagat taGATAATGA
TTACTTGTTT AAACTCAAAA TTTGTGTATA TTTATTTCGA TCCATCACAA CTCATGGGAT GTGATGCTAG TTTATCATAA
TTTAAAATGT GCATGATTAT CCTTGATTCA GATATCTATA TCCATTGCCA TCAACTTCTT ATTTGTTTTG ATGCGTGCTC
ATATTGATCA TGCTTTTAGA TAGCAATATC ATACAAGTAT GGTACTGCCA TTATTCAAAT GTTTTTGAGC CTCAGCCTTT
CCCACCCCTT GTCACTGTCT TGGGGCAATA TTTAACTATT GAAGAATTAA CTATGCTTTG CAGGGCACCT GTGGGGCCTG
TTTGCAATAA GAAACCCCGT GGCTACTAAT GACTACTAAT ACAACTCACA GTCTTAATCG TGTGTGTTAT CATACAGGGA
GGCTTTCAGA CAAACATTGA AAATTCTTGC TGACCATATT ATTTTCTTTT TCATAAATAA ACACTATCAA GGGTCACCTT
TTGTGGGCTT GCTTATTTGC ACTGAAGATG AATTTGGAAA GGTACTAAAG TACTAGTGGC TTAGAATTTG GCTATGCAAG
GTTAGCAGGA GAACCGGTAT TGCTAATTTG TGCTAAGGAT GAAATTGGTA GGTGCTGAAG TACTAAATGA TGGGAGTTTG
GCTAGGTAAA GCTTGAAAGA GAAAGTCTTC CTAGGATATG ATAGATAAAT CAAGGAATTT GTTGCTCACT GTGCCCAAAA
tcttaataca atgatacaca aagcttatgt gtattcgcga aaaaTGTGCC CAAAATCTAA CCAACCAACT GCTAACCTTG
CTAGGCAAGG TAGGCTAAGG AACCAAACAT GGTTGCTAAT TGCTATTGCT TTCTGATCAA ACATTCTGTT CGATGATTTT
CTCCTGTAGA CTTTATTACA AGATCCTTTT AGTTACACTT TTGTGATGCA TCATGCATGC TTACAGTTAC TTATATCTGC
AATTTTTTAG TATGTCTACT AATGGCTGAT TTCTTCAATT ATGAATTCCC TGCTCTGCTG CTGGTACATA AAACTGATGC
TAGCATCTTA TGTCGGATGA CTATTTTTCA GAACAAGTTT AGACATTGAA CTTAAAAGTA AAACTATAGC AGATCGATTC
ATCTGCACAA TTTATTAGTT TGTAACATGG GAGGCTAGGA CTATTACCTA ATCGAGAATG CAACTGACAA TGTTTGTTAT
TCTTATTTTG CAGTGTTGGA AATATCATAA GTTTTGGGAC AAGCAAGAGA GGACATGGAG CCATCATCAC AACCTCAGCC
GGCAATTGGT GTTGTTGCTG GTGGATCACA AGTGTACCCT GCATACCGGC CTGCAGCAAC AGTGCCTACA GCTCCTGCTG
TCATTCCTGC CGGTTCACAG CCAGCACCGT CGTTCCCTGC CAACCCTGAT CAACTGAGTG CTCAGCACCA GCTCGTCTAT
CAGCAAGCCC AGCAATTTCA CCAGCAGCTT CAGCAGCAGC AACAGCGTCA ACTCCAGCAG TTTTGGGCTG AACGTCTGGT
CGATATTGAA CAAACTACTG ACTTCAAGAA CCACAGCTTG CCACTTGCTA GGATAAAGAA GATCATGAAG GCAGATGAGG
ACGTTCGCAT GATCTCCGCA GAGGCTCCTG TGATCTTTGC GAAAGCATGT GAGATATTCA TACTGGAGCT GACCCTGAGA
TCATGGATGC ACACGGAGGA GAACAAGCGC CGTACCTTGC AGAAGAATGA CATAGCAGCT GCCATCACCA GGACGGATAT
GTACGATTTC TTGGTAGATA TAGTTCCCAG GGATGACTTG AAGGAGGAGG GAGTTGGGCT CCCTAGGGCT GGATTGCCGC
CCTTGGGTGT CCCTGCTGAC TCATATCCGT ATGGCTACTA TGTGCCACAG CAGCAGGTCC CAGGTGCAGG AATAGCGTAT
GGTGGTCAGC AAGGTCATCC GGGGTATCTG TGGCAGGATC CTCAGGAACA GCAGGAAGAG CCTCCTGCAG AGCAGCAAAG
TGATTAAGAA GAGTAAATGA TCCCTGTGAA TTGTCAAGAA GCTTACCACC TGATTCAGAA TTTTACTTTT AGCCAGGTTG
TCGTCTATTC TGAATTTATG AATAGGATTA GGATTCTCTC ATGGTAGTTG CATTTCTGCT GTAGTGGAAA AGGATTTATG
ACATGAGAGT ATGAGACTAA TGGGTTTCAG TTACTATACC GTTTCCTGTC AATCCAAAAG TTGGCCTTTG CGAGGCCATT
GATATTGAAC CTAATGTGGT TGAACTGCCC ATGCCAACGT TTGTAAGCTC TGATGTGGGT CATTCTGTAT TTCATGTTTG
CATGGTTTCA TGGAATCTTC TTTGTTTAGA CAATGAAAAT GTTTTACATT CGTGGCATCT GCCATAACAC