Os06t0670500-01

Locus

Os06g0670500

Description

Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP59B

CGSNL Gene Name

CYCLOPHILIN 59B

Oryzabase Gene Symbol Synonym(s)

OsCYP59b, OsCYP-15, OsCYP59-2

Oryzabase Gene Name Synonym(s)

cyclophilin 59b, cyclophilin 15

Transcript Evidence

AK072223 (DDBJ, Best hit)

AK099323 (DDBJ, Best hit)

Protein Evidence

NP_175776.2 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

RNA recognition motif domain (IPR000504)

Zinc finger, CCHC-type (IPR001878)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Nucleotide-binding, alpha-beta plait (IPR012677)

Zinc finger, CCHC retroviral-type (IPR013084)

Cyclophilin-like (IPR015891)

Full-length cDNA

J013166F20 (Online Clone Ordering)

J033008G16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0670500-01)

Others

Oryzabase (10074)

Transcript

2152 bp

>Os06t0670500-01 Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.
ATAAAAAACAAAAAAGAAAAAAAATAGAAACACCTCGTCGGCGTTTAGAAAGGCGGTTGG
GGTTCGGCGGCGGCGGCGGAGGCCGGTGAGTATCCGCGGCCGCGCGAACCAGTCGCCTGA
GCTCCCAGAAGCATCCGGCGCTGCGGCTCCTCCGTGATTTGTGTATTTTTCCCCTTGAAT
CCCGCGCCGTCGCGGCCGCCGTGTGCTCTTGCCGCCGGCGAGAAGGGGGGAAAACGCCCG
CGGAGATGTCGGTCCTCATCGTGACCAGCGTGGGGGACATCGAGGTGGACCTCCACACCG
ACATGTGCCCCCTCACCACCAAGAACTTCCTCAAGCTCTGCAAGATGAAGTATTACAATG
GGTGCCTGTTCCACAAGGTGGAGAAGGATTTCTTGGCACAAACTGGGGACCCAACTGGAA
CAGGAGCTGGAGGCGATTCTGTATACAAGTTCCTTTATGGTGATCAAGCTCGATTTTTTG
ATGATGAGATCCGACCAGACCTTAGGCATTCAAAAAAGGGAACTATTGCTATGGCGAGTG
CTGGTGAAAATTGCAATGCCTCGCAGTTCTATATCACCTTGCGGGATGACGTAGACTACC
TTGATGATAAACACACAGTGTTCGGCATGGTTGCTGAAGGCTTTGACACGCTGACAAAGA
TTAGTGAAACATATGTTGATGATAAAGGGAGACCATTTAAGGACATCAGGATTAAACATA
CGTATGTCTTGGATGATCCTTTTGACGATCCTCCTCAGCTCAGTGAACTTATTCCTGAGA
ATTCTCCTGTAGGGAAACCACAGGATGAGATTGCAGAAGAGCGCTTAGAGGATAGCTGGG
TCCCTATGGATGAAATGGTGGCTCCTGAAGAACTTGAGGAGATGATCCGCTCCAAAGAAG
CACATACAAATGCTGTGATTCTTGAGAGCGTGGGAGATATTCCAGATGCTGAGATCAAAC
CACCAGACAACGTTTTATTTGTTTGTAAACTCAACCCAGTAACACAAGATGAAGATTTAT
ATACAATTTTTTCTCGTTTTGGAACTGTGACATCAGCTGAAATAATCCGTGATTACAAGA
CTGGTGATAGCTTATGCTATGCTTTTATTGAATTTGAGACAAAGGAGGCTTGTGAGCGGG
CATTCTTCAAGATGGACAATTGTTTGATTGATGATCGAAGAATACATGTTGACTTTAGTC
AAAGTGTTTCAAAACTGTGGGGTCAGTTCAGACAAAGCAAAAGAAATGCAAATAAAGATG
GATGCTTCAAGTGTGGCGCCCCTGATCACATAGCCAAAGACTGTGACCAGGGCACTGAGC
AGAAAAACAAAGGCCCAAGTTATGTCCTGAAAGATGAAAACACTCAGCGTGGTGGAAATA
ACCGTCGAAGCTATGATCTTGTCTTTGATGAAGATGGTGAAAATTATACTGATCAGCAAG
ATCCTGGAAGTACTGGCCGAAGAAAGATTCAAAGAACAGATGATCGCAAATCAGGGCTGC
CACCTCGGGGTGACCATGACAGGATTAGCCGGGAGAGAACTCACAGTGATGAGAATGGTA
GAGAAGGTGGTAAAGAAGGTGATAGGGACCGAGGGATTCGTAAGCACGAGGACTACCACC
GTTACAATAAATCTGGTGAACGGAGCTCTAGTAGATACGATGATCGTGGCTACAGCAAGC
ACGAGAGCAGGGGCAAATATAGGGATGGCAATGATGATTACAGACGACAACCGGGAGGTG
GCAGTCGATATGGCAGGGATAAGTATGAAGGTGAACGGCGCTACAGAGAAGATGATGGCC
ATGGAAGGAGTGACCGTCACAAGAGAGATGAAAGTGATAACAGGAAAAGAAGCCCAGATA
CTGGTAAGCATAGAAGAGAAGACGGTGGTCACCGTGAGACAAGCAAGCACAGGGAAAGGA
GGCAGAGAGATGATAGATAGGTCACTGCATCACCGTCAGTTTTGTCTTGCCTGTTTCTCA
TCATACATTGAATTTTGTCATTCTTAATCCAAAGATAGCACCAGAACACTAAACATGTAG
CTTAGAATCTGCGTGTAGACATTATGAGAGCTCCACTGGCTACAGATTGTTGTAACTTGT
AGACCTTTTCTTTTCTATACATGCTCATGGACGTTGTTCTTTTTGGGGGACG

CDS

1695 bp

>Os06t0670500-01 Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.
ATGTCGGTCCTCATCGTGACCAGCGTGGGGGACATCGAGGTGGACCTCCACACCGACATG
TGCCCCCTCACCACCAAGAACTTCCTCAAGCTCTGCAAGATGAAGTATTACAATGGGTGC
CTGTTCCACAAGGTGGAGAAGGATTTCTTGGCACAAACTGGGGACCCAACTGGAACAGGA
GCTGGAGGCGATTCTGTATACAAGTTCCTTTATGGTGATCAAGCTCGATTTTTTGATGAT
GAGATCCGACCAGACCTTAGGCATTCAAAAAAGGGAACTATTGCTATGGCGAGTGCTGGT
GAAAATTGCAATGCCTCGCAGTTCTATATCACCTTGCGGGATGACGTAGACTACCTTGAT
GATAAACACACAGTGTTCGGCATGGTTGCTGAAGGCTTTGACACGCTGACAAAGATTAGT
GAAACATATGTTGATGATAAAGGGAGACCATTTAAGGACATCAGGATTAAACATACGTAT
GTCTTGGATGATCCTTTTGACGATCCTCCTCAGCTCAGTGAACTTATTCCTGAGAATTCT
CCTGTAGGGAAACCACAGGATGAGATTGCAGAAGAGCGCTTAGAGGATAGCTGGGTCCCT
ATGGATGAAATGGTGGCTCCTGAAGAACTTGAGGAGATGATCCGCTCCAAAGAAGCACAT
ACAAATGCTGTGATTCTTGAGAGCGTGGGAGATATTCCAGATGCTGAGATCAAACCACCA
GACAACGTTTTATTTGTTTGTAAACTCAACCCAGTAACACAAGATGAAGATTTATATACA
ATTTTTTCTCGTTTTGGAACTGTGACATCAGCTGAAATAATCCGTGATTACAAGACTGGT
GATAGCTTATGCTATGCTTTTATTGAATTTGAGACAAAGGAGGCTTGTGAGCGGGCATTC
TTCAAGATGGACAATTGTTTGATTGATGATCGAAGAATACATGTTGACTTTAGTCAAAGT
GTTTCAAAACTGTGGGGTCAGTTCAGACAAAGCAAAAGAAATGCAAATAAAGATGGATGC
TTCAAGTGTGGCGCCCCTGATCACATAGCCAAAGACTGTGACCAGGGCACTGAGCAGAAA
AACAAAGGCCCAAGTTATGTCCTGAAAGATGAAAACACTCAGCGTGGTGGAAATAACCGT
CGAAGCTATGATCTTGTCTTTGATGAAGATGGTGAAAATTATACTGATCAGCAAGATCCT
GGAAGTACTGGCCGAAGAAAGATTCAAAGAACAGATGATCGCAAATCAGGGCTGCCACCT
CGGGGTGACCATGACAGGATTAGCCGGGAGAGAACTCACAGTGATGAGAATGGTAGAGAA
GGTGGTAAAGAAGGTGATAGGGACCGAGGGATTCGTAAGCACGAGGACTACCACCGTTAC
AATAAATCTGGTGAACGGAGCTCTAGTAGATACGATGATCGTGGCTACAGCAAGCACGAG
AGCAGGGGCAAATATAGGGATGGCAATGATGATTACAGACGACAACCGGGAGGTGGCAGT
CGATATGGCAGGGATAAGTATGAAGGTGAACGGCGCTACAGAGAAGATGATGGCCATGGA
AGGAGTGACCGTCACAAGAGAGATGAAAGTGATAACAGGAAAAGAAGCCCAGATACTGGT
AAGCATAGAAGAGAAGACGGTGGTCACCGTGAGACAAGCAAGCACAGGGAAAGGAGGCAG
AGAGATGATAGATAG

Protein

565 aa

>Os06t0670500-01 Similar to Multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase.
MSVLIVTSVGDIEVDLHTDMCPLTTKNFLKLCKMKYYNGCLFHKVEKDFLAQTGDPTGTG
AGGDSVYKFLYGDQARFFDDEIRPDLRHSKKGTIAMASAGENCNASQFYITLRDDVDYLD
DKHTVFGMVAEGFDTLTKISETYVDDKGRPFKDIRIKHTYVLDDPFDDPPQLSELIPENS
PVGKPQDEIAEERLEDSWVPMDEMVAPEELEEMIRSKEAHTNAVILESVGDIPDAEIKPP
DNVLFVCKLNPVTQDEDLYTIFSRFGTVTSAEIIRDYKTGDSLCYAFIEFETKEACERAF
FKMDNCLIDDRRIHVDFSQSVSKLWGQFRQSKRNANKDGCFKCGAPDHIAKDCDQGTEQK
NKGPSYVLKDENTQRGGNNRRSYDLVFDEDGENYTDQQDPGSTGRRKIQRTDDRKSGLPP
RGDHDRISRERTHSDENGREGGKEGDRDRGIRKHEDYHRYNKSGERSSSRYDDRGYSKHE
SRGKYRDGNDDYRRQPGGGSRYGRDKYEGERRYREDDGHGRSDRHKRDESDNRKRSPDTG
KHRREDGGHRETSKHRERRQRDDR*

5'UTR

chr06:27792515..27792759 (+ strand) : 245 bp

CDS

chr06:27792760..27792857 (+ strand) : 98 bp

chr06:27793384..27793488 (+ strand) : 105 bp

chr06:27793568..27793685 (+ strand) : 118 bp

chr06:27793833..27793883 (+ strand) : 51 bp

chr06:27793981..27794072 (+ strand) : 92 bp

chr06:27794211..27794310 (+ strand) : 100 bp

chr06:27794671..27794790 (+ strand) : 120 bp

chr06:27794880..27794957 (+ strand) : 78 bp

chr06:27795121..27795167 (+ strand) : 47 bp

chr06:27795250..27795305 (+ strand) : 56 bp

chr06:27795946..27795986 (+ strand) : 41 bp

chr06:27796223..27796328 (+ strand) : 106 bp

chr06:27797544..27797676 (+ strand) : 133 bp

chr06:27797749..27798298 (+ strand) : 550 bp

3'UTR

chr06:27798299..27798510 (+ strand) : 212 bp

FASTA

>Os06t0670500-01 class=Sequence position=chr06:27792515..27798510 (+ strand)
ATAAAAAACA AAAAAGAAAA AAAATAGAAA CACCTCGTCG GCGTTTAGAA AGGCGGTTGG GGTTCGGCGG CGGCGGCGGA
GGCCGGTGAG TATCCGCGGC CGCGCGAACC AGTCGCCTGA GCTCCCAGAA GCATCCGGCG CTGCGGCTCC TCCGTGATTT
GTGTATTTTT CCCCTTGAAT CCCGCGCCGT CGCGGCCGCC GTGTGCTCTT GCCGCCGGCG AGAAGGGGGG AAAACGCCCG
CGGAGATGTC GGTCCTCATC GTGACCAGCG TGGGGGACAT CGAGGTGGAC CTCCACACCG ACATGTGCCC CCTCACCACC
AAGAACTTCC TCAAGCTCTG CAAGTAAGCT TTCAGTTTAC CCGCATCTAG GGCTTGTTCT ATCTGTAAGT GCGCGGGATC
ATCTGGCTAG TACCAGGGGT AACGCTGTCT CGCGGTTGAG GGGTTAGCCC TCACGAAGCA GTTTAGCGGC CAATTTTGGC
GTTGCAGAGG GTGCTACTTG GTGTGGATTT GGTGTTGTAT TCTAGAACCG CGAAGGGTGT ATGAACTATG GAGTCTGCTG
GGTTAAGATT AATTATAATT TAAGCTGCTG CTGATGTGTC GTGAATCATT GTGAATGAAT TTACCTTCTT AGTGTAGTCA
TTAAAATGTA GGATGGAAAG ATTGGGTCAA TTAGGGGATC GCTCTTTGAT TATTAGGGTT GTTATCTGAA TTGAAAAAAA
AAGTATGCTT ACTGATATTG CAAAATAATG CACAATAGCA GTATTATGAA TATGAAATAG TAATTTTATG GTTATGAAAT
ATAGCTGAGT TGACTATTTA TAGCAATGGG AGTAATCATC CTCATTCCTC CTATGATTTG ACTTACCAGG ATGAAGTATT
ACAATGGGTG CCTGTTCCAC AAGGTGGAGA AGGATTTCTT GGCACAAACT GGGGACCCAA CTGGAACAGG AGCTGGAGGC
GATTCTGTAT ACAAGTAAAC AATTGCTCAG ATGTTTTACT GCCACTGATT GTTGAATACA TGCCTGAAAA GGGATTCATT
TGTTTTTCTG TAGGTTCCTT TATGGTGATC AAGCTCGATT TTTTGATGAT GAGATCCGAC CAGACCTTAG GCATTCAAAA
AAGGGAACTA TTGCTATGGC GAGTGCTGGT GAAAATTGCA ATGCCTCGCA GGTGTGATAC CATATTCCTA GCCTTCCTAC
CGAACTTAGC TCAGCTGTTT TGATAACCAG TACTTGATAA TCCATTTTGA GGTCCTTAAC TCCTTGCTGC TAACCTGCTA
TTTCTAACCT TTGATTTATG TTTCTGTGAC TTTATTAGTT CTATATCACC TTGCGGGATG ACGTAGACTA CCTTGATGAT
AAACACACAG TGAGTAGTAC CTTATTATAT TGACTCACAG AATATTTTCT TTGGAAAAAT CCACTTTATC TACAGTGATT
CATATGTATG TCCTTATCAA TTATAGGTGT TCGGCATGGT TGCTGAAGGC TTTGACACGC TGACAAAGAT TAGTGAAACA
TATGTTGATG ATAAAGGGAG ACCATTTAAG GACATCAGGT AAAATACCTT TTTTAAAAAG TCTAAACTGA ATAATTAGAA
CATGCTTGCT AATATTTACT TACTTTCTGG TGTTACTTTC TGTTGTTTCT GCTTTATTTC CAACTGCTGA CCTTCTGCAA
AATGTTCAAT GGACAGGATT AAACATACGT ATGTCTTGGA TGATCCTTTT GACGATCCTC CTCAGCTCAG TGAACTTATT
CCTGAGAATT CTCCTGTAGG GAAACCACAG GATGAGGTAA TATGAGTTCT GCTATTTTGC TCATGTTGGA AAGATGATAA
ACCAAAATTG TCTCACCAAA ATCACAGGCT GTCTTTTGTT TAATTCGTTT TACCTCCACA TTCTTGAAAA CTATTTATTT
GTGCACATAC CTTTTTAAAA GAATATGGTA TGAATTTCAG TTGAGGCAGC CACTGGGTGT AGGTGTATTT TTTTTCCTTG
TTCTGTCTGT ACAAATTATC CCGATCCCTA AAATATCTAG ACAGGCATGT TTCAGATTAG TCCTAGAAGG GTGTGGTTTT
GCCGTGATTC TCCTGAATGC TATGTGTTGT CCTTTTAACA TGGTCATGAT ATTTTCTTTT CACTGTCAAT GTACAGATTG
CAGAAGAGCG CTTAGAGGAT AGCTGGGTCC CTATGGATGA AATGGTGGCT CCTGAAGAAC TTGAGGAGAT GATCCGCTCC
AAAGAAGCAC ATACAAATGC TGTGATTCTT GAGAGCGTGA GTCCTGATGC CAAATAAAAA ATTAACAGTT CGCTCATTAT
TATTCATCGT GTTATAACTG ATAAAAATAC CTTTGTCTTA TTCAGGTGGG AGATATTCCA GATGCTGAGA TCAAACCACC
AGACAACGTT TTATTTGTTT GTAAACTCAA CCCAGTAACA CAAGTTCGTA TCGGTTCTTA ATTGATTGGC TTTGTTCTCT
ACTTCCACTA CCTTTTTATG TATAGATTCA CAGATCAGTT TGGAAGTCAT ATAGGTATTG AATTTATAGC AATATAGCTT
GAAATATTGT TTGGTAACTA AACGGCTAGT GTTCATTGTT TTGTAGGATG AAGATTTATA TACAATTTTT TCTCGTTTTG
GAACTGTGAC ATCGTAAGCG CATTTTCCTA AGTTCAATTA ATGTGCATAT CTTCCTGTTT CTTATTTTGT TAACTTTTTT
TATTATTCCT TGCAGAGCTG AAATAATCCG TGATTACAAG ACTGGTGATA GCTTATGCTA TGCTTTTATT GGTGAGTTTC
ATTCCTCAAA AGCTGGTGTA CATTGACATA CTGTGATCAA GCATCGGATT GTTGTTAGCT AGAGTTATGC TAGTCCGTTC
ATCGAACGCT TGAGCTTCAT TGATAGCTTT CCCAGGCATT CATCCTCCAA TTCTTTAGGC GTGTTGAACA TCATGTTTTA
CCCTCTTAGA TCTGTTATCC TAGTAAGGAA CAACTGAGTG ACCTAATTTG CAACAAGGTT CTGGTGTTTT GTGTAAGGCT
GAGTTCCAAA TGTTAGTGGC TATGGATATA CTTTAGTTGC AGCATGTAAA GCACACCTTT TAGTTTGTTA ATACTTAATA
AACCAGCAAA TGGGTTAAAT GCATGACGTG GCAAAAAGAC TAATGGTGTT TACTTGTATC TCCTCAAAAA TAAACATTAA
CGATTTAAGA AAACAAACTG AGTAGCTCCA TTGCACACTT CTGAGGTATT AAACAATATA AGTTTCTTGA TAGCTCAATT
TTTCTCTCAG GGTTACGGTG TCAGTGTGAT ATTTGGCACA GACTGCAGTA GACAGTAGAT GGCCTAGAAA GAATTTATTG
TTCCACCTTG ATAAATTGGC AAGATCTGAA TGCTATTATA AAATGCTAAA TTTTATCTTG CTCTTTTGTA GAATTTGAGA
CAAAGGAGGC TTGTGAGCGG GCATTCTTCA AGGTTAGTTG CCTAAAATCC TGTTTCATGT GGCAGATAAA ACTTGGTTCT
TGTAATTGTA CTTTATTTCC CTTCATTACT TAGCATTTCT TTGCTAGCAT ATTTTTATAA GTCATTTTTG CTTGACTAGT
GAATGTTACT TGATTGTTTG TGCCTTGACA ATTCAGTATT GTCTATATTT GTAATTATTT TACCAGTGTT TTCATGGGAG
CATTGCTTAC TCAATGATAT GCTTGCAGAT GGACAATTGT TTGATTGATG ATCGAAGAAT ACATGTTGAC TTTAGTCAAA
GTGTTTCAAA ACTGTGGGGT CAGTTCAGAC AAAGCAAAAG AAATGCAAAT AAAGGTATTC TTATTTCCAT GGCCTTAGAA
TATGATTGCA GTTTTCAGTT TCTTTTTTAT TTAAGCTAAC TGCATGGTAG CTTTCTTTTT TCTTAAGGAA AAGCAGTAGG
GGAGATCCTC TACTGTTACC CTTTCCTACA AGGAAAAGAA CTATATAAAT CTATCCTTCA TCAAAATTCT TTTCATCTAG
ACTTTGGTGG CACTCAATTT CCTTTCAGAC CATAATTATA GCATCCTCCT GTATCCTATA GAAATTTATT TATTCCTATA
AGGAATTTAG TGTTTTGTAC CATGCGGAAG ATGTCTAGAG AAGTGTACTG ATTATTATTC AGCACAGTTA AACCGTGTCA
AGTGTAAAGA TGGCAACAAT GTTCCCAATA AGCCACAGGA CAAAGAAGAA AGTAAACATC AATCTGAGCA AGACTTCCAA
CATGTTTTGC TTTCTCCTTA GCATCTCTTT AGTATCGCAT CTCTGTCTTT AACATGCATT TGTTCTCTGG AGTTCATCTG
TAAATGGCAG AAGTGTGATC TGAATACTGT GTCTTAGTAT ATTAGAAGTC TGCAGAGCCC CTAACAGAAT ATATTATTAC
TAGTCTTTAT ATTACCAGTT TTTGGCTAAA CCACTTGCCG CGGATGGTTC AGATTGTGGC AAATAGCAAA CTGGCCTAGC
GTCATCATTT GCTAGGCATT CTGAAACTCA GATTGTTGGT TTCTTTGTAT ATGTAATATA CGATCAATTT CAAATAGCCC
TGTACTCAAC TTAGCCATTA ATTCTTCCAG TACCAAACTA ACAGACCATG TTTTATTTCT TACAATATGA GCTGAGCAAT
GGACCTGAAT ATTCATATCT GCTTAAGATC ATTTCTCTAC TAGAGTAACT TGCACAATTG GTGAGCCATG GAACTGAATT
CTCATAAGAG ACCTTTGCCA TAGAATATTA AATCATGAAA TTCCTATTTT TCTGTAGAAA AGGTTGATTT ATGAAATAAT
TTTGATACGA AACATCTCAT CTTATATTTC TAGGTTGACC ACATCCAAGC CCATTAATCT ATAGGTACTA GGAAGTAGGA
AGGTGTACGC AGATGCCCAC TTCATTGCGG AATTTAACAT TCTCAACTAG GACTCTTGAA CTCTAGTTAG TTGTGAGACC
ATACTTTTTT ACTATTTTGG AGTTAGAATT AATTCACATG AAAGCTATAT GATGCAATTC TCTTTGCAGA TGGATGCTTC
AAGTGTGGCG CCCCTGATCA CATAGCCAAA GACTGTGACC AGGGCACTGA GCAGAAAAAC AAAGGCCCAA GTTATGTCCT
GAAAGATGAA AACACTCAGC GTGGTGGAAA TAACCGTCGA AGGTCATTTT CTTTTCCCTA TCTATCATAT TTCCTGATCG
TCTCATTTTC TGATAATCTT CTGTTGTTTT GCAGCTATGA TCTTGTCTTT GATGAAGATG GTGAAAATTA TACTGATCAG
CAAGATCCTG GAAGTACTGG CCGAAGAAAG ATTCAAAGAA CAGATGATCG CAAATCAGGG CTGCCACCTC GGGGTGACCA
TGACAGGATT AGCCGGGAGA GAACTCACAG TGATGAGAAT GGTAGAGAAG GTGGTAAAGA AGGTGATAGG GACCGAGGGA
TTCGTAAGCA CGAGGACTAC CACCGTTACA ATAAATCTGG TGAACGGAGC TCTAGTAGAT ACGATGATCG TGGCTACAGC
AAGCACGAGA GCAGGGGCAA ATATAGGGAT GGCAATGATG ATTACAGACG ACAACCGGGA GGTGGCAGTC GATATGGCAG
GGATAAGTAT GAAGGTGAAC GGCGCTACAG AGAAGATGAT GGCCATGGAA GGAGTGACCG TCACAAGAGA GATGAAAGTG
ATAACAGGAA AAGAAGCCCA GATACTGGTA AGCATAGAAG AGAAGACGGT GGTCACCGTG AGACAAGCAA GCACAGGGAA
AGGAGGCAGA GAGATGATAG ATAGGTCACT GCATCACCGT CAGTTTTGTC TTGCCTGTTT CTCATCATAC ATTGAATTTT
GTCATTCTTA ATCCAAAGAT AGCACCAGAA CACTAAACAT GTAGCTTAGA ATCTGCGTGT AGACATTATG AGAGCTCCAC
TGGCTACAGA TTGTTGTAAC TTGTAGACCT TTTCTTTTCT ATACATGCTC ATGGACGTTG TTCTTTTTGG GGGACG

Locus: Os06g0670500

Loading...

Locus: Os06g0670500

Loading...