Os06t0671900-01

Locus

Os06g0671900

Description

Similar to Tubulin beta-3 chain.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TUB3

CGSNL Gene Name

BETA-TUBULIN 3

Oryzabase Gene Symbol Synonym(s)

OsTUB3, TUBB3, RTUB-2

Oryzabase Gene Name Synonym(s)

beta tubulin 3, Tubulin beta-3 chain, Beta-3-tubulin, beta tubulin 2

Transcript Evidence

AK069237 (DDBJ, Best hit)

Protein Evidence

Q40665 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: microtubule-based movement (GO:0007018)

Biological Process: protein polymerization (GO:0051258)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural molecule activity (GO:0005198)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Beta tubulin, autoregulation binding site (IPR013838)

Tubulin, conserved site (IPR017975)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Full-length cDNA

J023010B07 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0671900-01)

RiceXPro (AK069237)

Others

Oryzabase (2958)

KEGG (Os06t0671900-01)

Transcript

1798 bp

>Os06t0671900-01 Similar to Tubulin beta-3 chain.
CCCCTCTCCGCCATCTCCAACGCCGCCTCCTCCTCCTCCTCCTCAACCCCACCCACCTCG
CCGCCGCCGCCGTCGCCGCCGCCGCCGCCGCCATGAGGGAGATCCTGCACATCCAGGGGG
GCCAATGCGGGAACCAGATCGGGGCCAAGTTCTGGGAGGTGATCTGCGACGAGCACGGGA
TCGACCACACCGGCAAGTACTCCGGCGACTCCGACCTCCAGCTCGAGCGGATCAACGTCT
ACTACAACGAGGCCAGCGGCGGCCGCTACGTGCCCCGCGCCGTGCTCATGGACCTCGAGC
CCGGCACCATGGACTCCGTCCGCTCCGGCCCCTATGGCCAGATCTTCCGCCCCGACAACT
TCGTCTTCGGCCAGTCCGGCGCCGGCAACAACTGGGCCAAGGGCCACTACACCGAGGGCG
CCGAGCTCATCGACTCCGTCCTCGACGTCGTCCGCAAGGAGGCCGAGAACTGCGACTGCC
TCCAAGGGTTCCAGGTTTGCCACTCGCTGGGAGGAGGAACTGGCTCCGGGATGGGAACCC
TGCTCATCTCCAAGATCAGGGAGGAGTACCCTGACCGGATGATGCTCACGTTCTCGGTCT
TCCCATCGCCCAAGGTGTCCGACACTGTCGTCGAGCCCTACAATGCTACCCTCTCTGTGC
ACCAGCTTGTTGAGAATGCGGATGAGTGCATGGTTCTTGACAATGAGGCTCTCTACGACA
TCTGCTTCCGCACGCTCAAGCTCGCGACACCTACTTtcggtgatctcaaccatcttatct
ctgcaacaatgagtggtgttacctgctgcctccgcttccctggccagttgaactctgacc
tccggaagcttgctgtcaacctgatccctttcccgcggctccacttcttcatggttggat
tcgctcctctgacttccaggggatcccagcagtaccgtgccctcactgtaccagagctga
cccagcagatgtgggatgcaaagaacatgatgtgtgctgctgacccccgccatgggcgct
acctcacagcctcagccatgttccgcggaaagatgagcaccaaggaagttgatgagcaga
tgctgaatgtccagaacaagaaCTCGTCATACTTTGTGGAGTGGATCCCTAACAATGTCA
AGTCGAGTGTGTGTGACATTCCACCCATTGGCCTGAAGATGGCATCCACATTCATCGGCA
ACTCGACCTCAATCCAGGAGATGTTCCGCCGTGTCAGTGAGCAGTTCACCGCCATGTTCA
GGAGGAAGGCTTTCTTGCACTGGTACACTGGTGAGGGAATGGACGAGATGGAGTTCACCG
AGGCTGAGAGCAACATGAACGACCTGGTAGCTGAATACCAGCAGTACCAGGATGCCACCG
CTGAGGAAGAGGACTATGAGGAGGAAGAGGAGGACGAGGAGGTTGCTGCCTAAGCCACCT
CTCTGCATGTTTGAGCTATATAGATATCCCTTGTGACATTTGCTACTACTAGTTACCATC
GTTGATTGGGGGTGCTTGTTAGATGCTAGGTTAATGTTATTATTTCCAAATACTATGTTG
CCTTGTCGGACTATTTTTATCTGGGTTAATGGTATGTTCAACATTATTGTCTTGAGGTGG
ATTAACTGTTGGAAGTATGTAGCAAAGCTTGAGGTGGAATGCATATGAAACTGAACTTTA
GCTTTGCAGGGCTTATTGGACCACCTCTGCGTGTTTGAACTAAAATGCCACCTCCGACGA
CCCCCTGGGTTATCAACTTGATTATAAAATAAATATTTTAGAAAATGTTTTTTTTTGG

CDS

1341 bp

>Os06t0671900-01 Similar to Tubulin beta-3 chain.
ATGAGGGAGATCCTGCACATCCAGGGGGGCCAATGCGGGAACCAGATCGGGGCCAAGTTC
TGGGAGGTGATCTGCGACGAGCACGGGATCGACCACACCGGCAAGTACTCCGGCGACTCC
GACCTCCAGCTCGAGCGGATCAACGTCTACTACAACGAGGCCAGCGGCGGCCGCTACGTG
CCCCGCGCCGTGCTCATGGACCTCGAGCCCGGCACCATGGACTCCGTCCGCTCCGGCCCC
TATGGCCAGATCTTCCGCCCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGCCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTC
CGCAAGGAGGCCGAGAACTGCGACTGCCTCCAAGGGTTCCAGGTTTGCCACTCGCTGGGA
GGAGGAACTGGCTCCGGGATGGGAACCCTGCTCATCTCCAAGATCAGGGAGGAGTACCCT
GACCGGATGATGCTCACGTTCTCGGTCTTCCCATCGCCCAAGGTGTCCGACACTGTCGTC
GAGCCCTACAATGCTACCCTCTCTGTGCACCAGCTTGTTGAGAATGCGGATGAGTGCATG
GTTCTTGACAATGAGGCTCTCTACGACATCTGCTTCCGCACGCTCAAGCTCGCGACACCT
ACTTtcggtgatctcaaccatcttatctctgcaacaatgagtggtgttacctgctgcctc
cgcttccctggccagttgaactctgacctccggaagcttgctgtcaacctgatccctttc
ccgcggctccacttcttcatggttggattcgctcctctgacttccaggggatcccagcag
taccgtgccctcactgtaccagagctgacccagcagatgtgggatgcaaagaacatgatg
tgtgctgctgacccccgccatgggcgctacctcacagcctcagccatgttccgcggaaag
atgagcaccaaggaagttgatgagcagatgctgaatgtccagaacaagaaCTCGTCATAC
TTTGTGGAGTGGATCCCTAACAATGTCAAGTCGAGTGTGTGTGACATTCCACCCATTGGC
CTGAAGATGGCATCCACATTCATCGGCAACTCGACCTCAATCCAGGAGATGTTCCGCCGT
GTCAGTGAGCAGTTCACCGCCATGTTCAGGAGGAAGGCTTTCTTGCACTGGTACACTGGT
GAGGGAATGGACGAGATGGAGTTCACCGAGGCTGAGAGCAACATGAACGACCTGGTAGCT
GAATACCAGCAGTACCAGGATGCCACCGCTGAGGAAGAGGACTATGAGGAGGAAGAGGAG
GACGAGGAGGTTGCTGCCTAA

Protein

447 aa

>Os06t0671900-01 Similar to Tubulin beta-3 chain.
MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLERINVYYNEASGGRYV
PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPIG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVA
EYQQYQDATAEEEDYEEEEEDEEVAA*

5'UTR

chr06:27880033..27880124 (- strand) : 92 bp

CDS

chr06:27879639..27880032 (- strand) : 394 bp

chr06:27879124..27879393 (- strand) : 270 bp

chr06:27877891..27878567 (- strand) : 677 bp

3'UTR

chr06:27877526..27877890 (- strand) : 365 bp

FASTA

>Os06t0671900-01 class=Sequence position=chr06:27877526..27880124 (- strand)
CCCCTCTCCG CCATCTCCAA CGCCGCCTCC TCCTCCTCCT CCTCAACCCC ACCCACCTCG CCGCCGCCGC CGTCGCCGCC
GCCGCCGCCG CCATGAGGGA GATCCTGCAC ATCCAGGGGG GCCAATGCGG GAACCAGATC GGGGCCAAGT TCTGGGAGGT
GATCTGCGAC GAGCACGGGA TCGACCACAC CGGCAAGTAC TCCGGCGACT CCGACCTCCA GCTCGAGCGG ATCAACGTCT
ACTACAACGA GGCCAGCGGC GGCCGCTACG TGCCCCGCGC CGTGCTCATG GACCTCGAGC CCGGCACCAT GGACTCCGTC
CGCTCCGGCC CCTATGGCCA GATCTTCCGC CCCGACAACT TCGTCTTCGG CCAGTCCGGC GCCGGCAACA ACTGGGCCAA
GGGCCACTAC ACCGAGGGCG CCGAGCTCAT CGACTCCGTC CTCGACGTCG TCCGCAAGGA GGCCGAGAAC TGCGACTGCC
TCCAAGGTAA ACCCTAAATC ACCAGATCTG CGCGTTTCCC CGCCTTCTCC TCTCGCTCGA TTTAGCCATA GCCTTGTAGA
TCTAGGGGAT TTGGGTCGTA GATCTGAAGA AATTCGGGCC AGATCTGGAG ATTCATGAGG GAGTTTGAAG GATTAGGCGA
CTAATAATTT CTGGTTCTCC GAGTGATTCA ATGTAGGTTT CCATTTCAAC TTGTTTGAGT GATGATCTCA CTCTCGCTCG
CCTCGCTGCA GGGTTCCAGG TTTGCCACTC GCTGGGAGGA GGAACTGGCT CCGGGATGGG AACCCTGCTC ATCTCCAAGA
TCAGGGAGGA GTACCCTGAC CGGATGATGC TCACGTTCTC GGTCTTCCCA TCGCCCAAGG TGTCCGACAC TGTCGTCGAG
CCCTACAATG CTACCCTCTC TGTGCACCAG CTTGTTGAGA ATGCGGATGA GTGCATGGTT CTTGACAATG AGGCTCTCTA
CGACATCTGC TTCCGCACGC TCAAGCTCGC GACACCTACT TGTAAGTACA AAGAAGTCTC TGCAAGTCTG CAGTGATGTT
TGTGTGTTTC ATTTGTGGAT GATCATTCAG TGATTCGGTA GAATTTAGCA TAGTTTTGTG TATACTGTTT CCCTGGTGTG
GCACATGCTA AACATCATGC TGTTATTTGA TTATGGCTAG CAATTCTGTA ATCCTCCATG AGTGTTACTA GCTGTTTATA
TGTTATCACT CTATATACTC TTCAGTCTTC ATTTCTGTGA TATGCTCTCC ACATTCTGAT GTGAGTTTAC CTAATTCTAC
TGTTACCCGT CACAGTTTAG AAGGGTAAAT GCACCAATGG TTTCATACAT ATTGCTAACT TTGGATCATC AGAAGTTCAT
TTTGATACTT GTTATCCTAC TAAACATCTG TGTGTACCAT GTATTTTGTA TAATTAGTAT AGCATGATAG AAGAAAAAAA
TGACTTTTCA ATTTATGGTA ATCTTCTGGG AGCATATATT TGTTAAAGCT AGGTCTTGTC TAGTTTATAT GAGATTGTGC
CTTGTGGTTC TTAATGATTT TTACTTTGtt ttttcagtcg gtgatctcaa ccatcttatc tctgcaacaa tgagtggtgt
tacctgctgc ctccgcttcc ctggccagtt gaactctgac ctccggaagc ttgctgtcaa cctgatccct ttcccgcggc
tccacttctt catggttgga ttcgctcctc tgacttccag gggatcccag cagtaccgtg ccctcactgt accagagctg
acccagcaga tgtgggatgc aaagaacatg atgtgtgctg ctgacccccg ccatgggcgc tacctcacag cctcagccat
gttccgcgga aagatgagca ccaaggaagt tgatgagcag atgctgaatg tccagaacaa gaaCTCGTCA TACTTTGTGG
AGTGGATCCC TAACAATGTC AAGTCGAGTG TGTGTGACAT TCCACCCATT GGCCTGAAGA TGGCATCCAC ATTCATCGGC
AACTCGACCT CAATCCAGGA GATGTTCCGC CGTGTCAGTG AGCAGTTCAC CGCCATGTTC AGGAGGAAGG CTTTCTTGCA
CTGGTACACT GGTGAGGGAA TGGACGAGAT GGAGTTCACC GAGGCTGAGA GCAACATGAA CGACCTGGTA GCTGAATACC
AGCAGTACCA GGATGCCACC GCTGAGGAAG AGGACTATGA GGAGGAAGAG GAGGACGAGG AGGTTGCTGC CTAAGCCACC
TCTCTGCATG TTTGAGCTAT ATAGATATCC CTTGTGACAT TTGCTACTAC TAGTTACCAT CGTTGATTGG GGGTGCTTGT
TAGATGCTAG GTTAATGTTA TTATTTCCAA ATACTATGTT GCCTTGTCGG ACTATTTTTA TCTGGGTTAA TGGTATGTTC
AACATTATTG TCTTGAGGTG GATTAACTGT TGGAAGTATG TAGCAAAGCT TGAGGTGGAA TGCATATGAA ACTGAACTTT
AGCTTTGCAG GGCTTATTGG ACCACCTCTG CGTGTTTGAA CTAAAATGCC ACCTCCGACG ACCCCCTGGG TTATCAACTT
GATTATAAAA TAAATATTTT AGAAAATGTT TTTTTTTGG

Locus: Os06g0671900

Loading...

Locus: Os06g0671900

Loading...