Os06t0677800-01

Locus

Os06g0677800

Description

ARF transcription factor, Defense against different types of plant viruses

RAP-DB Gene Symbol Synonym(s)

OsARF17

RAP-DB Gene Name Synonym(s)

auxin response factor 17

CGSNL Gene Symbol

ARF17

CGSNL Gene Name

AUXIN RESPONSE FACTOR 17

Oryzabase Gene Symbol Synonym(s)

OsARF17

Oryzabase Gene Name Synonym(s)

auxin response factor-17, auxin response factor 17

Transcript Evidence

AK103280

Protein Evidence

Q653U3

Literature

PMID: 32253321

Note

Manual Curation

April 9, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: response to hormone (GO:0009725)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

DNA-binding pseudobarrel domain superfamily (IPR015300)

B3 DNA binding domain (IPR003340)

Auxin response factor (IPR010525)

AUX/IAA domain (IPR033389)

PB1 domain (IPR000270)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J033124L19 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0677800-01)

RiceXPro (AK103280)

Others

Oryzabase (10013)

KEGG (Os06t0677800-01)

Transcript

3731 bp

>Os06t0677800-01 ARF transcription factor, Defense against different types of plant viruses
AGGAAGCTGCAAGAGGAACTGAGGAAGGAAGCAAGAAAGCAAACCAAACCAAACCAAACC
AAGAAGCAAATCTCAGTTGCAACTCTTGAGCTCAGAAGAAGTTGCAACAGAAGAAGGAGG
GAGAAGGGAAGCATCTCAGCTAGCTAGGCAGGAAGCATGCTCCTAGCCTCCCTCTCCGGC
TGCGGCGGCGGCGGCGGCGGTCGGATCTGCCGGAGAGCGGCGGCCGGGGAGCCCAGAGCT
GAGAGCTAACCGTGCAGACCTCGCGGCCGCGAGATCTGACCACGCGACTCCTCGGATCAA
GCGGTGTCGCCTCCCGCAGCAGCATTTCCCCCCCCCCCCCCCCCCCCGAAGATCACAGCC
TTTTTTTCCACTGGTTCTTGCTGGTCTTGGAAGTGGGGAAAAAAAATTCTCATCACCTCG
TCGATGGAGAAGCTTACGACGCTTGCTCGGTAGATTTGATTTTTCTTTTTCTTCTTCTTC
CGGGGGAAGCGTAATTGCGAAACAGCGAAAGAAGAAGTGTTGGTGAGTTGGCGAAACTGA
GAAAGCGATGGTTTTTGGGAAGGCGCTGTGATTTGGCCTAAAAAGGAGGAATCTTTCCTT
CGTTCTCTCCTTCCTTCCCCAGCTTCGTGCACGCTCTTATATTGCATTTCAGATCGGTCT
TGTGATTGGTCTTTTGGAGAGAGAGAGAGAGAGAGAAGAAAAATGAGGCTTTCGTCGTCG
TCCGGCAGCGTCCTCCCGGCTCAGGCGGCGTCGCCGGAAGCTGTAGAAGAACAAAAATGC
CTGAATTCGGAGCTCTGGCATGCGTGTGCCGGTCCCCTTGTTTCGTTGCCTGCAGTGGGT
AGCCGAGTGGTTTATTTCCCACAGGGTCACAGCGAACAGGTAGCTGCATCAACAAATAAA
GAAATGGAGTCTCAGATCCCCAATTATCCTAACTTGCCTCCACAACTTATTTGCCAACTT
CACAATGTGACGATGCATGCAGATGCAGAAACAGATGAGGTTTACGCTCAGATGACGCTA
CAACCACTTAGCCCGCAAGAGCTCAAGGACCCATATCTACCAGCTGAATTAGGTTCTGCC
AACAAACAGCCAACGAATTATTTTTGCAAAACATTAACGGCAAGTGACACAAGTACGCAT
GGCGGATTCTCTGTTCCCCGTCGAGCAGCTGAGAAAGTGTTCCCTCCGCTGGATTTTACT
CAGCAGCCTCCAGCACAGGAGTTAATTGCAAAAGATCTTCATGGCAATGAGTGGAAGTTT
CGTCATATCTTTCGTGGTCAGCCAAAGCGACACCTTCTAACTACAGGCTGGAGCGTCTTT
GTAAGTGCAAAGAGACTTGTCGCCGGGGATTCTGTCCTATTTATCTGGAATGACAACAAC
CAGCTTCTTCTGGGAATTCGTCGAGCTAACCGCCCACAAACTGTTATGCCATCTTCAGTC
CTATCTAGTGATAGCATGCATATTGGTCTTCTTGCTGCGGCTGCTCATGCTGCTTCAACA
AATAGCCGGTTTACAATTTTTTATAACCCAAGAGCAAGCCCTTCAGAGTTTGTTATCCCA
CTTTCTAAATATGTTAAGGCTGTATATCATACCCGTATATCTGTGGGCATGCGTTTCAGG
ATGCTTTTTGAGACAGAAGAGTCAAGTGTACGGAGATACATGGGCACGATAACAGGAATT
AGTGATCTTGATGCTGCTCGTTGGCCAAACTCACATTGGCGTTCTGTAAAGGTTGGCTGG
GATGAATCAACTGCCGGAGAGAGGCAGCCAAGGGTGTCGCTTTGGGAGATTGAGCCCTTG
ACAACTTTCCCAATGTACCCATCTCCTTTTCCACTCAGACTGAAGCGTCCATGGCCAACA
GGCTTGCCTTCATTACATGGTGGTAAGGATGACGACTTGACTTCTTCTCTCATGTGGCTC
CGAGACAGCGCAAATCCTGGTTTCCAATCATTGAATTTCGGGGGTCTCGGTATGAATCCT
TGGATGCAGCCAAGGTTTGATGCTTCCTTACTTGGTCTGCAACCTGACATGTATCAAACG
ATAGCTGCGACTGCTTTCCAGGACCCAACAAAGCAGGTCTCTCCCACGATATTGCAGTTC
CAGCAGCCGCAGAACATAGGTGGCAGAGCTAATACACTTCTGCCAAGTCAGATTTTGCAG
CAAGTGCAGCCTCAGTTTCAGCAGCAGCAATACCTCCAAAACATCAACGAGACCACAATC
CAAGGGCATGCTCAGTCTGAGTTCCTTCAGCAGCAGCTCCAACGCTGCCAGTCGTTTACT
GAGCAGAAGCCACAGCTGCAAACCCAGCAACAACAGCAAGAATCACAGCAACAACAGCAG
CAGCAATCGCAGTGTATGCAAGTCCCACAACATCAGCAAATGCAACAGCAGAAGAACATG
ACCAACTATCAGTCTGTACCTAATGCATTGTCACCGTTTTCTCAACTCTCCTCTCCTTCT
CAGTCTTCACCTATGACACTGCAAACAGTATTACCATTCTCCCAGCCACAGAGCTATCCA
GACACGAGTATGAGCTCATTGTCACCATCCAACACATCCACCATGCATAATGCATTGAGG
CCATTTTCATCGGAAGCACCTTCGCACCTAAGCATGCCAAGACCGACTGCAGTACCTGTC
CCTGACCCATGGTCATCGAAGCGAGTTGCAGTGGAGTCTTTGCTTCCCTCTCGTCCTCAG
GTTACATCGCAGATGGAGCAGTTGGACTCAACAGCACCTAGTATACCACAAAGCTCTGCG
TTGGCGCCGCTTCCTGGAAGAGGATGCTTGGTGGATCAAGATGGGAACTCTGATCCTCAA
AACCATCTGTTATTTGGCGTTAACATAGATTCACAGTCACTTCTAATGCAAGGTGGCATC
CCAAGCCTCCAGGGTGAGAATGATTCGACGGCAATTCCTTATTCCACCTCCAATTTCCTG
AGCCCGTCGCAGAATGATTTCCCCTTGGATCAAACACTAAGTAGTGCAGACTGCTTAGAT
GAATCAGGATATGTGCCGTGTTCACAGAATTCTGATCAAGTGATTAATCGACCACCTGCG
ACCTTTGTGAAGGTTTACAAATCGGGAACCTATGGAAGGTCACTTGATATCACTAGATTT
AGTAGCTATCATGAACTTCGTAGAGAACTAGGGCGCCTATTTGGCCTTGAGGGCCAGTTG
GAAAACCCTTTGAGATCAGGCTGGCAGCTTGTATTCGTCGACCGAGAGGATGATGTCCTC
CTCGTTGGCGACGACCCTTGGCAGGAATTCGTGAATAGCGTCTCCTGCATAAAGATACTT
TCACCACAGGAGGTGCAGCAGATGGGCAAGCCCTTTGAGCTTTTGAGCTCGGCTCCCGGA
AAGAGGCTAGGTAGCAGCTGTGATGACTATGTGAGCAGGCAGGAATCAAGAAGCCTGAGC
ACAGGAATTGCATCTGTCGGCTCAGTTGAATTCTGAAGCAAGGGCGCTAACGAGCCCTTC
AATCAAATCTAGCCTGTTACCTATGTTTCTGCAGTTTTTCTTCCCCTAGTTTTGAGACCT
GGAACTGAAAGAACATAGATCCATGCTTAGCTAAGTTATGTACCATCTAATAATTATGCT
ATATGATATCAAATTCCAAGTAGAAACTATCAACTTTTGGTATATATATATATACCAAAA
CTTTGTTCCATGAAACACTAATCCTGTGAATGTAGGCCATCTAAATTATCAGGCTCACCG
CGAAGTTTAGC

CDS

2754 bp

>Os06t0677800-01 ARF transcription factor, Defense against different types of plant viruses
ATGAGGCTTTCGTCGTCGTCCGGCAGCGTCCTCCCGGCTCAGGCGGCGTCGCCGGAAGCT
GTAGAAGAACAAAAATGCCTGAATTCGGAGCTCTGGCATGCGTGTGCCGGTCCCCTTGTT
TCGTTGCCTGCAGTGGGTAGCCGAGTGGTTTATTTCCCACAGGGTCACAGCGAACAGGTA
GCTGCATCAACAAATAAAGAAATGGAGTCTCAGATCCCCAATTATCCTAACTTGCCTCCA
CAACTTATTTGCCAACTTCACAATGTGACGATGCATGCAGATGCAGAAACAGATGAGGTT
TACGCTCAGATGACGCTACAACCACTTAGCCCGCAAGAGCTCAAGGACCCATATCTACCA
GCTGAATTAGGTTCTGCCAACAAACAGCCAACGAATTATTTTTGCAAAACATTAACGGCA
AGTGACACAAGTACGCATGGCGGATTCTCTGTTCCCCGTCGAGCAGCTGAGAAAGTGTTC
CCTCCGCTGGATTTTACTCAGCAGCCTCCAGCACAGGAGTTAATTGCAAAAGATCTTCAT
GGCAATGAGTGGAAGTTTCGTCATATCTTTCGTGGTCAGCCAAAGCGACACCTTCTAACT
ACAGGCTGGAGCGTCTTTGTAAGTGCAAAGAGACTTGTCGCCGGGGATTCTGTCCTATTT
ATCTGGAATGACAACAACCAGCTTCTTCTGGGAATTCGTCGAGCTAACCGCCCACAAACT
GTTATGCCATCTTCAGTCCTATCTAGTGATAGCATGCATATTGGTCTTCTTGCTGCGGCT
GCTCATGCTGCTTCAACAAATAGCCGGTTTACAATTTTTTATAACCCAAGAGCAAGCCCT
TCAGAGTTTGTTATCCCACTTTCTAAATATGTTAAGGCTGTATATCATACCCGTATATCT
GTGGGCATGCGTTTCAGGATGCTTTTTGAGACAGAAGAGTCAAGTGTACGGAGATACATG
GGCACGATAACAGGAATTAGTGATCTTGATGCTGCTCGTTGGCCAAACTCACATTGGCGT
TCTGTAAAGGTTGGCTGGGATGAATCAACTGCCGGAGAGAGGCAGCCAAGGGTGTCGCTT
TGGGAGATTGAGCCCTTGACAACTTTCCCAATGTACCCATCTCCTTTTCCACTCAGACTG
AAGCGTCCATGGCCAACAGGCTTGCCTTCATTACATGGTGGTAAGGATGACGACTTGACT
TCTTCTCTCATGTGGCTCCGAGACAGCGCAAATCCTGGTTTCCAATCATTGAATTTCGGG
GGTCTCGGTATGAATCCTTGGATGCAGCCAAGGTTTGATGCTTCCTTACTTGGTCTGCAA
CCTGACATGTATCAAACGATAGCTGCGACTGCTTTCCAGGACCCAACAAAGCAGGTCTCT
CCCACGATATTGCAGTTCCAGCAGCCGCAGAACATAGGTGGCAGAGCTAATACACTTCTG
CCAAGTCAGATTTTGCAGCAAGTGCAGCCTCAGTTTCAGCAGCAGCAATACCTCCAAAAC
ATCAACGAGACCACAATCCAAGGGCATGCTCAGTCTGAGTTCCTTCAGCAGCAGCTCCAA
CGCTGCCAGTCGTTTACTGAGCAGAAGCCACAGCTGCAAACCCAGCAACAACAGCAAGAA
TCACAGCAACAACAGCAGCAGCAATCGCAGTGTATGCAAGTCCCACAACATCAGCAAATG
CAACAGCAGAAGAACATGACCAACTATCAGTCTGTACCTAATGCATTGTCACCGTTTTCT
CAACTCTCCTCTCCTTCTCAGTCTTCACCTATGACACTGCAAACAGTATTACCATTCTCC
CAGCCACAGAGCTATCCAGACACGAGTATGAGCTCATTGTCACCATCCAACACATCCACC
ATGCATAATGCATTGAGGCCATTTTCATCGGAAGCACCTTCGCACCTAAGCATGCCAAGA
CCGACTGCAGTACCTGTCCCTGACCCATGGTCATCGAAGCGAGTTGCAGTGGAGTCTTTG
CTTCCCTCTCGTCCTCAGGTTACATCGCAGATGGAGCAGTTGGACTCAACAGCACCTAGT
ATACCACAAAGCTCTGCGTTGGCGCCGCTTCCTGGAAGAGGATGCTTGGTGGATCAAGAT
GGGAACTCTGATCCTCAAAACCATCTGTTATTTGGCGTTAACATAGATTCACAGTCACTT
CTAATGCAAGGTGGCATCCCAAGCCTCCAGGGTGAGAATGATTCGACGGCAATTCCTTAT
TCCACCTCCAATTTCCTGAGCCCGTCGCAGAATGATTTCCCCTTGGATCAAACACTAAGT
AGTGCAGACTGCTTAGATGAATCAGGATATGTGCCGTGTTCACAGAATTCTGATCAAGTG
ATTAATCGACCACCTGCGACCTTTGTGAAGGTTTACAAATCGGGAACCTATGGAAGGTCA
CTTGATATCACTAGATTTAGTAGCTATCATGAACTTCGTAGAGAACTAGGGCGCCTATTT
GGCCTTGAGGGCCAGTTGGAAAACCCTTTGAGATCAGGCTGGCAGCTTGTATTCGTCGAC
CGAGAGGATGATGTCCTCCTCGTTGGCGACGACCCTTGGCAGGAATTCGTGAATAGCGTC
TCCTGCATAAAGATACTTTCACCACAGGAGGTGCAGCAGATGGGCAAGCCCTTTGAGCTT
TTGAGCTCGGCTCCCGGAAAGAGGCTAGGTAGCAGCTGTGATGACTATGTGAGCAGGCAG
GAATCAAGAAGCCTGAGCACAGGAATTGCATCTGTCGGCTCAGTTGAATTCTGA

Protein

918 aa

>Os06t0677800-01 ARF transcription factor, Defense against different types of plant viruses
MRLSSSSGSVLPAQAASPEAVEEQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQV
AASTNKEMESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDPYLP
AELGSANKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIAKDLH
GNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQT
VMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRIS
VGMRFRMLFETEESSVRRYMGTITGISDLDAARWPNSHWRSVKVGWDESTAGERQPRVSL
WEIEPLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLTSSLMWLRDSANPGFQSLNFG
GLGMNPWMQPRFDASLLGLQPDMYQTIAATAFQDPTKQVSPTILQFQQPQNIGGRANTLL
PSQILQQVQPQFQQQQYLQNINETTIQGHAQSEFLQQQLQRCQSFTEQKPQLQTQQQQQE
SQQQQQQQSQCMQVPQHQQMQQQKNMTNYQSVPNALSPFSQLSSPSQSSPMTLQTVLPFS
QPQSYPDTSMSSLSPSNTSTMHNALRPFSSEAPSHLSMPRPTAVPVPDPWSSKRVAVESL
LPSRPQVTSQMEQLDSTAPSIPQSSALAPLPGRGCLVDQDGNSDPQNHLLFGVNIDSQSL
LMQGGIPSLQGENDSTAIPYSTSNFLSPSQNDFPLDQTLSSADCLDESGYVPCSQNSDQV
INRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQLVFVD
REDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKPFELLSSAPGKRLGSSCDDYVSRQ
ESRSLSTGIASVGSVEF*

5'UTR

chr06:28163856..28164557 (- strand) : 702 bp

CDS

chr06:28163798..28163855 (- strand) : 58 bp

chr06:28163034..28163152 (- strand) : 119 bp

chr06:28162791..28162889 (- strand) : 99 bp

chr06:28162645..28162701 (- strand) : 57 bp

chr06:28162398..28162553 (- strand) : 156 bp

chr06:28162233..28162317 (- strand) : 85 bp

chr06:28161822..28161912 (- strand) : 91 bp

chr06:28161539..28161703 (- strand) : 165 bp

chr06:28161349..28161471 (- strand) : 123 bp

chr06:28161187..28161262 (- strand) : 76 bp

chr06:28160859..28161006 (- strand) : 148 bp

chr06:28159560..28160752 (- strand) : 1193 bp

chr06:28159067..28159257 (- strand) : 191 bp

chr06:28158794..28158986 (- strand) : 193 bp

3'UTR

chr06:28158519..28158793 (- strand) : 275 bp

FASTA

>Os06t0677800-01 class=Sequence position=chr06:28158519..28164557 (- strand)
AGGAAGCTGC AAGAGGAACT GAGGAAGGAA GCAAGAAAGC AAACCAAACC AAACCAAACC AAGAAGCAAA TCTCAGTTGC
AACTCTTGAG CTCAGAAGAA GTTGCAACAG AAGAAGGAGG GAGAAGGGAA GCATCTCAGC TAGCTAGGCA GGAAGCATGC
TCCTAGCCTC CCTCTCCGGC TGCGGCGGCG GCGGCGGCGG TCGGATCTGC CGGAGAGCGG CGGCCGGGGA GCCCAGAGCT
GAGAGCTAAC CGTGCAGACC TCGCGGCCGC GAGATCTGAC CACGCGACTC CTCGGATCAA GCGGTGTCGC CTCCCGCAGC
AGCATTTCCC CCCCCCCCCC CCCCCCCGAA GATCACAGCC TTTTTTTCCA CTGGTTCTTG CTGGTCTTGG AAGTGGGGAA
AAAAAATTCT CATCACCTCG TCGATGGAGA AGCTTACGAC GCTTGCTCGG TAGATTTGAT TTTTCTTTTT CTTCTTCTTC
CGGGGGAAGC GTAATTGCGA AACAGCGAAA GAAGAAGTGT TGGTGAGTTG GCGAAACTGA GAAAGCGATG GTTTTTGGGA
AGGCGCTGTG ATTTGGCCTA AAAAGGAGGA ATCTTTCCTT CGTTCTCTCC TTCCTTCCCC AGCTTCGTGC ACGCTCTTAT
ATTGCATTTC AGATCGGTCT TGTGATTGGT CTTTTGGAGA GAGAGAGAGA GAGAGAAGAA AAATGAGGCT TTCGTCGTCG
TCCGGCAGCG TCCTCCCGGC TCAGGCGGCG TCGCCGGAAG GTACTACTTC TTGTTTTTTT TTAAAATTCA GAGTTTTCTG
TGCTCCGTGG CTTGCTCATT AATGCCATCT TTGTTCATTT ATTCAGAGTG TATTATGAAG TTCATAGGAC TAGTATGTAT
TTGGTTGCTG TTTGTTCGTA TGCCTTGCTT GAAAGTTTCA GAGCTCGTAT TTTGGACTGT GTTCTTTGTG ATCAGGAAGC
TACAGAATGC GGCAAATTTG AGCTCTCTCT GTTATTTGGA TTTATTCTGA TGATTTATTT TGGAAAGGAT GTACTAATTG
GCATGTGAAT TTCTTTCCCT CCCCCTTTGG ATTTTGGCCT TCTGTTCCCA TGAAATTTCA GTTCTGTAAT CATGTATATG
CTGTCTATTT TCGATCCAAT TCTTACTTAT GCCTTGATTC CTTTGGACTG TTCTTTCCTG AGACTTTTTT TTGTGCTTAT
CACCTCCATA ATAGTCTATT TTCTAGGAAT ATGCAAAGAG AAAAAAGGCC CTTGCCCAAT GTTAGGCCAC TGAGAAGTTC
ATTTAGTACC ATATCCACCT CCTCTAACAA TGCTGAGCAT ATGAAATCAG AAATGTTACA CTTTATGCTC CCTAGCATTG
TTTGTTAAAA CTTGGTCTTC TGACCAACTG CTTTTGCCAT TACAGCTGTA GAAGAACAAA AATGCCTGAA TTCGGAGCTC
TGGCATGCGT GTGCCGGTCC CCTTGTTTCG TTGCCTGCAG TGGGTAGCCG AGTGGTTTAT TTCCCACAGG GTCACAGCGA
ACAGGTTAGA ATTTTTTCAC TCCACTACAA GTAATGCTTG AGAGTATCAT GTGATGGTTT CACTGCCAAA TTGAAATCCG
ATTTGATTCT ATCAGAAATC AGTTGCTTCC ATTTCTGTGT AAATTCATCG GGTCAATTGC TGCCGCAGGT AGCTGCATCA
ACAAATAAAG AAATGGAGTC TCAGATCCCC AATTATCCTA ACTTGCCTCC ACAACTTATT TGCCAACTTC ACAATGTGAC
GATGCATGTA AGTTTAGAGA ACATCTTTTT TTCGTTTCCA GAGCCAAGTA ATCTCACTGC TGACCTTGTG TTGCATCGTC
TGCTTATTTC CTTCAGGCAG ATGCAGAAAC AGATGAGGTT TACGCTCAGA TGACGCTACA ACCACTTAGC CCGGTAATTC
ATAATTTTTA TAACCACTTG TGCTATGTGC AAATTTCTAA GTAGTCTCCA AGAGAATAAT TTTTGGGCTT TCTTTTCTTT
TCAGCAAGAG CTCAAGGACC CATATCTACC AGCTGAATTA GGTTCTGCCA ACAAACAGCC AACGAATTAT TTTTGCAAAA
CATTAACGGC AAGTGACACA AGTACGCATG GCGGATTCTC TGTTCCCCGT CGAGCAGCTG AGAAAGTGTT CCCTCCGCTG
GTTTGTGCTG TTTTTCTCCC GTTTTCCAGT TATTCTTTTA ATTGGTTCAT CATCTGTTCT AATTGTCTTT AATTTTGTAG
GATTTTACTC AGCAGCCTCC AGCACAGGAG TTAATTGCAA AAGATCTTCA TGGCAATGAG TGGAAGTTTC GTCATATCTT
TCGTGGTGAG CAGTTTTTTC CTATTGTCAT TTCTAAGTCC TCTGATAATA AACTATGTAT TACCTTTTAC AGTTGTGATA
AATACTATCC ATTAAACTCT GGTAGCCATT GAGGTCAATT TATCTTTGTA AATGAAAGGA ACAAAAATCC TTAAATATGT
AATGGAAATA AGGAAAATTA AATTAATGTT TTTCATGATA AAATGGATCA AACATGGAGC CATGGAGGTG ATTTTTTTTC
ATTGGGGCTG GATTATTTGC TTAACAAAAA CGAGTAGCTT AAGGTGAGAA CAAAGCTTGC TCATATATTC TAATTTGTGG
TGCAGGTCAG CCAAAGCGAC ACCTTCTAAC TACAGGCTGG AGCGTCTTTG TAAGTGCAAA GAGACTTGTC GCCGGGGATT
CTGTCCTATT TATCTGGTAC ATTTATTTAT CAAAGATGCA GAATGATCAC TTGACACTGT CCTGTGCTTA GCCATTTACG
TTTCAGTGGA GAGATTGTTT GTGGTTTTAT ATATGTATTT CCTTGCATTG TCAGGAATGA CAACAACCAG CTTCTTCTGG
GAATTCGTCG AGCTAACCGC CCACAAACTG TTATGCCATC TTCAGTCCTA TCTAGTGATA GCATGCATAT TGGTCTTCTT
GCTGCGGCTG CTCATGCTGC TTCAACAAAT AGCCGGTTTA CAATTTTTTA TAACCCAAGG TAATATTTTT GTATAACATT
TATTTACTCA GAATTCCTCC TAACTATTCC CTTCCGTTTA ATGCAGAGCA AGCCCTTCAG AGTTTGTTAT CCCACTTTCT
AAATATGTTA AGGCTGTATA TCATACCCGT ATATCTGTGG GCATGCGTTT CAGGATGCTT TTTGAGACAG AAGAGTCAAG
TGTACGGAGG TATGATGAAT TGTGTTTGCC TGGTAAATTT TCATAGACTC AAAAGTACAT AACTGCCTGA CAGGATCAAA
TATTCTTATT TGCAGATACA TGGGCACGAT AACAGGAATT AGTGATCTTG ATGCTGCTCG TTGGCCAAAC TCACATTGGC
GTTCTGTAAA GGTACATTTC CAGGCTAGCA TTTTTTCTTA TTGCCTTCAA TCCTGTTCTT TACACATTTG ACCATACAAG
TTTTCTGTTA GGCAGGATGA AATTTCCTCT TTGGATTGCG TGTTGGTCTC ATCGTCCTGG TACCAACATT ATGGTTCAGC
ATGTTGATAG TGTTTTTCTT GGATAATGCA GGTTGGCTGG GATGAATCAA CTGCCGGAGA GAGGCAGCCA AGGGTGTCGC
TTTGGGAGAT TGAGCCCTTG ACAACTTTCC CAATGTACCC ATCTCCTTTT CCACTCAGAC TGAAGCGTCC ATGGCCAACA
GGCTTGCCTT CATTACATGG TAGGAGGGGC AGTTGATGTT TACTTCACAT TTTCAGATAG CTGCATAATT GATGTGTATT
ACTCTTTTAA ACTGTGAATC ATCTTTCAAT GATGACTACC TGTAGGTGGT AAGGATGACG ACTTGACTTC TTCTCTCATG
TGGCTCCGAG ACAGCGCAAA TCCTGGTTTC CAATCATTGA ATTTCGGGGG TCTCGGTATG AATCCTTGGA TGCAGCCAAG
GTTTGATGCT TCCTTACTTG GTCTGCAACC TGACATGTAT CAAACGATAG CTGCGACTGC TTTCCAGGAC CCAACAAAGC
AGGTCTCTCC CACGATATTG CAGTTCCAGC AGCCGCAGAA CATAGGTGGC AGAGCTAATA CACTTCTGCC AAGTCAGATT
TTGCAGCAAG TGCAGCCTCA GTTTCAGCAG CAGCAATACC TCCAAAACAT CAACGAGACC ACAATCCAAG GGCATGCTCA
GTCTGAGTTC CTTCAGCAGC AGCTCCAACG CTGCCAGTCG TTTACTGAGC AGAAGCCACA GCTGCAAACC CAGCAACAAC
AGCAAGAATC ACAGCAACAA CAGCAGCAGC AATCGCAGTG TATGCAAGTC CCACAACATC AGCAAATGCA ACAGCAGAAG
AACATGACCA ACTATCAGTC TGTACCTAAT GCATTGTCAC CGTTTTCTCA ACTCTCCTCT CCTTCTCAGT CTTCACCTAT
GACACTGCAA ACAGTATTAC CATTCTCCCA GCCACAGAGC TATCCAGACA CGAGTATGAG CTCATTGTCA CCATCCAACA
CATCCACCAT GCATAATGCA TTGAGGCCAT TTTCATCGGA AGCACCTTCG CACCTAAGCA TGCCAAGACC GACTGCAGTA
CCTGTCCCTG ACCCATGGTC ATCGAAGCGA GTTGCAGTGG AGTCTTTGCT TCCCTCTCGT CCTCAGGTTA CATCGCAGAT
GGAGCAGTTG GACTCAACAG CACCTAGTAT ACCACAAAGC TCTGCGTTGG CGCCGCTTCC TGGAAGAGGA TGCTTGGTGG
ATCAAGATGG GAACTCTGAT CCTCAAAACC ATCTGTTATT TGGCGTTAAC ATAGATTCAC AGTCACTTCT AATGCAAGGT
GGCATCCCAA GCCTCCAGGG TGAGAATGAT TCGACGGCAA TTCCTTATTC CACCTCCAAT TTCCTGAGCC CGTCGCAGAA
TGATTTCCCC TTGGATCAAA CACTAAGTAG TGCAGACTGC TTAGATGAAT CAGGATATGT GCCGTGTTCA CAGAATTCTG
ATCAAGTGAT TAATCGACCA CCTGCGACCT TTGTGAAGGT GAGTGCTTTC CTATGTCATA CTTCCCTGAA TCTGTCTCTC
TCTCGCTCTC TCTAATTTGT GCTTATGAGA TTGTCAGCTA TCCACTGTTT TGCTCATTAT ATGACTTTAT CACTAACTGT
GTATTGCTCT TTCCTTTAGA ATATATGTAA GTTGTGTGCT ATACATATGC ATGATAACTT TTGCCATTAG ATGTAATAAA
CTGCAGTGCA GTCTCTGAAA TGCTCAGTAT CTTGTTAACT TATTGATTAG TACTTCTTGG ATCACTGCTA ATCTGCAAAT
TGTTTCAATG TGAAAAACAG GTTTACAAAT CGGGAACCTA TGGAAGGTCA CTTGATATCA CTAGATTTAG TAGCTATCAT
GAACTTCGTA GAGAACTAGG GCGCCTATTT GGCCTTGAGG GCCAGTTGGA AAACCCTTTG AGATCAGGCT GGCAGCTTGT
ATTCGTCGAC CGAGAGGATG ATGTCCTCCT CGTTGGCGAC GACCCTTGGC AGTAAGTTTT TGTAAACTAT TCTGATGATA
ATTTGAGATA TTTCATGCTC TTCTTACAAC ATGAAACTTC GACAATTTCA GGGAATTCGT GAATAGCGTC TCCTGCATAA
AGATACTTTC ACCACAGGAG GTGCAGCAGA TGGGCAAGCC CTTTGAGCTT TTGAGCTCGG CTCCCGGAAA GAGGCTAGGT
AGCAGCTGTG ATGACTATGT GAGCAGGCAG GAATCAAGAA GCCTGAGCAC AGGAATTGCA TCTGTCGGCT CAGTTGAATT
CTGAAGCAAG GGCGCTAACG AGCCCTTCAA TCAAATCTAG CCTGTTACCT ATGTTTCTGC AGTTTTTCTT CCCCTAGTTT
TGAGACCTGG AACTGAAAGA ACATAGATCC ATGCTTAGCT AAGTTATGTA CCATCTAATA ATTATGCTAT ATGATATCAA
ATTCCAAGTA GAAACTATCA ACTTTTGGTA TATATATATA TACCAAAACT TTGTTCCATG AAACACTAAT CCTGTGAATG
TAGGCCATCT AAATTATCAG GCTCACCGCG AAGTTTAGC

Locus: Os06g0677800

Loading...

Locus: Os06g0677800

Loading...