Os06t0682750-00

Locus

Os06g0682750

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLLA5, LLA5, OsHyPRP21, HyPRP21

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein-like AGP 5, non-specific lipid transfer protein-like arabinogalactan protein 5, Hybrid Proline-Rich Protein 21

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os06t0682750-00)

Others

Oryzabase (11332)

Transcript

819 bp

>Os06t0682750-00
ATGGCGCCGTCGTCCAAGCTCGCCGCCCTCTTCTTCGCCTTCGCCGTCGTGGCGGCGGCG
GCGCTGGCACCGGCCGCAGAAGCGAGGGTCCAAGGGTTCAACCATGAAGCGGCGTCCGAG
CCTGCCATTGCCGCAGCCGGGGAGTCCAAAGCTGCCACCGGAGGAGGAGCGCCGACATTG
CCGGGATTACCCGGCTTGCCGTTCCCGCTCTTCCCGTTCCTCACGCTCCCGTTCCCGCTG
ATCCCCATCGGCGGCTCTTCTGGCGGCGGCGGCGCCGCTCCGCCTTCGGCTGGCTCTGGC
TTCCGGTTCCCGTTCCCGCTCCCGCTGCCGTTCCCTGCGCCCGCCTCGCCGGGCGGCGCT
CCGCCGTCGTCTGGGTCCGGCTTCCCGGCGTTCCCGTTCCCGTTCCCCAGCTCGCCGGTC
TCGCCACCGTCTCAAGCATCACCCGCCTCGCCGGCGGCACCGGCGCCGCCATCGCCGCCG
CAGCCAAAGGAGTGCTTGACGCCGCTGTTGTCGATGATGTCGTGCGCGGACTACCTGACG
AACAGCAGCGCGCAGACGCCGCCGGGCACCTGCTGCGAGGGGTTCAAGTCGCTGGTGAGC
ACGGCGCCCATCTGCCTGTGCCACGGCATCAATGGCGACCTGAGCAAGTTCCTCCCGCTC
CCCGTCGACATGATGAAGATGATGACGCTCCCCAACACCTGCGGCGCCACGGTCCCACTT
CAGACGTTCTCCATGTGCAACACGCCCTCGGTGCCTCCATTGATGCCTCAGAGCCCATCT
GCTGCTGCTCCAGCGCCTGGTAGTCCCCCATCGTCGTAA

CDS

819 bp

>Os06t0682750-00
ATGGCGCCGTCGTCCAAGCTCGCCGCCCTCTTCTTCGCCTTCGCCGTCGTGGCGGCGGCG
GCGCTGGCACCGGCCGCAGAAGCGAGGGTCCAAGGGTTCAACCATGAAGCGGCGTCCGAG
CCTGCCATTGCCGCAGCCGGGGAGTCCAAAGCTGCCACCGGAGGAGGAGCGCCGACATTG
CCGGGATTACCCGGCTTGCCGTTCCCGCTCTTCCCGTTCCTCACGCTCCCGTTCCCGCTG
ATCCCCATCGGCGGCTCTTCTGGCGGCGGCGGCGCCGCTCCGCCTTCGGCTGGCTCTGGC
TTCCGGTTCCCGTTCCCGCTCCCGCTGCCGTTCCCTGCGCCCGCCTCGCCGGGCGGCGCT
CCGCCGTCGTCTGGGTCCGGCTTCCCGGCGTTCCCGTTCCCGTTCCCCAGCTCGCCGGTC
TCGCCACCGTCTCAAGCATCACCCGCCTCGCCGGCGGCACCGGCGCCGCCATCGCCGCCG
CAGCCAAAGGAGTGCTTGACGCCGCTGTTGTCGATGATGTCGTGCGCGGACTACCTGACG
AACAGCAGCGCGCAGACGCCGCCGGGCACCTGCTGCGAGGGGTTCAAGTCGCTGGTGAGC
ACGGCGCCCATCTGCCTGTGCCACGGCATCAATGGCGACCTGAGCAAGTTCCTCCCGCTC
CCCGTCGACATGATGAAGATGATGACGCTCCCCAACACCTGCGGCGCCACGGTCCCACTT
CAGACGTTCTCCATGTGCAACACGCCCTCGGTGCCTCCATTGATGCCTCAGAGCCCATCT
GCTGCTGCTCCAGCGCCTGGTAGTCCCCCATCGTCGTAA

Protein

273 aa

>Os06t0682750-00
MAPSSKLAALFFAFAVVAAAALAPAAEARVQGFNHEAASEPAIAAAGESKAATGGGAPTL
PGLPGLPFPLFPFLTLPFPLIPIGGSSGGGGAAPPSAGSGFRFPFPLPLPFPAPASPGGA
PPSSGSGFPAFPFPFPSSPVSPPSQASPASPAAPAPPSPPQPKECLTPLLSMMSCADYLT
NSSAQTPPGTCCEGFKSLVSTAPICLCHGINGDLSKFLPLPVDMMKMMTLPNTCGATVPL
QTFSMCNTPSVPPLMPQSPSAAAPAPGSPPSS*

CDS

chr06:28449224..28449965 (- strand) : 742 bp

chr06:28448901..28448977 (- strand) : 77 bp

FASTA

>Os06t0682750-00 class=Sequence position=chr06:28448901..28449965 (- strand)
ATGGCGCCGT CGTCCAAGCT CGCCGCCCTC TTCTTCGCCT TCGCCGTCGT GGCGGCGGCG GCGCTGGCAC CGGCCGCAGA
AGCGAGGGTC CAAGGGTTCA ACCATGAAGC GGCGTCCGAG CCTGCCATTG CCGCAGCCGG GGAGTCCAAA GCTGCCACCG
GAGGAGGAGC GCCGACATTG CCGGGATTAC CCGGCTTGCC GTTCCCGCTC TTCCCGTTCC TCACGCTCCC GTTCCCGCTG
ATCCCCATCG GCGGCTCTTC TGGCGGCGGC GGCGCCGCTC CGCCTTCGGC TGGCTCTGGC TTCCGGTTCC CGTTCCCGCT
CCCGCTGCCG TTCCCTGCGC CCGCCTCGCC GGGCGGCGCT CCGCCGTCGT CTGGGTCCGG CTTCCCGGCG TTCCCGTTCC
CGTTCCCCAG CTCGCCGGTC TCGCCACCGT CTCAAGCATC ACCCGCCTCG CCGGCGGCAC CGGCGCCGCC ATCGCCGCCG
CAGCCAAAGG AGTGCTTGAC GCCGCTGTTG TCGATGATGT CGTGCGCGGA CTACCTGACG AACAGCAGCG CGCAGACGCC
GCCGGGCACC TGCTGCGAGG GGTTCAAGTC GCTGGTGAGC ACGGCGCCCA TCTGCCTGTG CCACGGCATC AATGGCGACC
TGAGCAAGTT CCTCCCGCTC CCCGTCGACA TGATGAAGAT GATGACGCTC CCCAACACCT GCGGCGCCAC GGTCCCACTT
CAGACGTTCT CCATGTGCAA CAGTAAGTTC TTGCTAATCA AATTACACCC TAATTAAACC CTATCGTAAA GCATGTTTAT
TATTTCTAAT GCATTGTTTG TTTGAAGATA ACATAATCCA TCGTAAAAAC ATGTTTTGTT TTTATGCATT GTTTCTTTGA
TTGAAGAGAT TAGTATAAAC CATCATGAAA CATGTTTATT TTTTCATGCA TTGCTTGTTT GATGAAGAGA TTAATTAATC
TAATCTGGTG TTTTGTTTGA TTTGACAGCG CCCTCGGTGC CTCCATTGAT GCCTCAGAGC CCATCTGCTG CTGCTCCAGC
GCCTGGTAGT CCCCCATCGT CGTAA

Locus: Os06g0682750

Loading...

Locus: Os06g0682750

Loading...