Os06t0693200-01

Locus

Os06g0693200

Description

Protein kinase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK216

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 216

Oryzabase Gene Symbol Synonym(s)

OsRLCK216, OsRRK1, RRK1

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 216, Rop-interacting receptor-like kinase 1

Transcript Evidence

AK105794 (DDBJ, Best hit)

Protein Evidence

Q01KL6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

001-202-H11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0693200-01)

RiceXPro (AK105794)

Others

Oryzabase (18912)

KEGG (Os06t0693200-01)

Transcript

1567 bp

>Os06t0693200-01 Protein kinase, core domain containing protein.
GTGCGTATCCCCGCGAAACGCCTCGTCGCGTTCATATTTGCTCACGGCTCGCGCGGCACT
CGCGAGAGCACCTCGGCGTTAGTACCCATCAATGCCTCCCTCCTCCTCCTCCTCCGCCAC
CACCACCAGCTCGCCGTCTCGTCTCCCTCCTCCGCTTCGCCTCCTCTGATCACCTCGCTC
GCCGGCGACGCCGCGATCGCCACCGCACCGCAGGGCATTGTGTCGTCGAGGGGAGAGATG
AGGCCTCTGTACCTGCGCAGCAGCGGCAGCTTCAAGAAGCTGCTCCTCTCCATCAGCCAC
CGCGGCGCCAAGAACGGCAATGGCGACGCCGCCGCCAAGGAGAGATACACGCCCGCCGCC
GCCGCGGCGGCGCCGGAGTCGCCGCGGAAGCCGGCGTGGCGGTGCTTCTCCTACGAGGAG
ATCCACCGCGCCACGAACGCGTTCCACGAGGGCAACCTGGTGGGGAAGGGCGGGTCGTCG
GAGGTGTACCGCGGCGAGCTCCCCGACGGGCGGGCCGTGGCGGTGAAGCGGCTGATGGGC
GCGTGGGCGTGCGAGCGGCGGGAGCGCGACTTCCTGGCGGAGCTCGGCACGGTGGGGCAC
GCGCGCCACCCCAACGTGTGCGCCCTCCTCGGCTGCTGcgtcgaccgcgacctctacctc
gtcttccacttctccggccgcggctccgtctccgccaacctccACGACGAGAAGAAGGCG
CCGGCGATGGGGTGGGCGGTGCGGCGCGCCATTGCCGTCggcacggcgagggggctggag
tacctgcacaaggggtgccagaggaggatcatccacagggacatcaaggcatccaacgtg
cttctcaccgacgactTCCAGCCTCAGATTTCCGATTTCGGGCTCGCCAAGTGGCTGCCG
TCGGAGTGGACGCACCGGGCGATCGCCCCGATCGAAGGAACATTCGGGTGTTTGGCACCG
GAGTACTACACGCATGGCATCGTCGACGAGAAGACGGACGTGTTCGCGTTCGGCGTCTTC
CTCCTGGAGATCATGACCGGGAGAAAGCCGGTGGATGGCAGCCACAAGAGCTTGCTCAGC
TGGGCGAGGCCGTTCCTGAACGAGGGGAGGATCGAGTCGCTGGTGGATCCGAGGATCGGC
GGCGACTACGACGGCGAGGAGGCGCGGCGGCTGGCGTTCGTGGCGTCGCTGTGCATCCGC
TCGTCGGCGAAGTGGAGGCCATCCATGACCGAGGTGCTGGAGCTGCTGGAAGGCGTCGAG
ATCCGGCAAGAACGGTGGACGATGCCCGAGGCAGTGGAGGACGACGACGACGAGGAGCTA
TGGAGATTCGATGACCTGGATGACGAAGATGACGAAGATGAAGAGGAGTTCAACACTGCA
TCCCCATCTTCTTGCTCATCATCTTTGAGCAATTAGTAGTTAGTAATAGTATCTAAGATT
GTGAGTAAGCTTGTGATGTTGTTACAAGATGAAATTTTTGATAGTTACTCTCCACTGGGC
CCACTTGTAAATAGAAAGGATTTTCATCTTATCATCATCCAACAGGCTATGAAAAGCAAG
TAGTACC

CDS

1179 bp

>Os06t0693200-01 Protein kinase, core domain containing protein.
ATGAGGCCTCTGTACCTGCGCAGCAGCGGCAGCTTCAAGAAGCTGCTCCTCTCCATCAGC
CACCGCGGCGCCAAGAACGGCAATGGCGACGCCGCCGCCAAGGAGAGATACACGCCCGCC
GCCGCCGCGGCGGCGCCGGAGTCGCCGCGGAAGCCGGCGTGGCGGTGCTTCTCCTACGAG
GAGATCCACCGCGCCACGAACGCGTTCCACGAGGGCAACCTGGTGGGGAAGGGCGGGTCG
TCGGAGGTGTACCGCGGCGAGCTCCCCGACGGGCGGGCCGTGGCGGTGAAGCGGCTGATG
GGCGCGTGGGCGTGCGAGCGGCGGGAGCGCGACTTCCTGGCGGAGCTCGGCACGGTGGGG
CACGCGCGCCACCCCAACGTGTGCGCCCTCCTCGGCTGCTGcgtcgaccgcgacctctac
ctcgtcttccacttctccggccgcggctccgtctccgccaacctccACGACGAGAAGAAG
GCGCCGGCGATGGGGTGGGCGGTGCGGCGCGCCATTGCCGTCggcacggcgagggggctg
gagtacctgcacaaggggtgccagaggaggatcatccacagggacatcaaggcatccaac
gtgcttctcaccgacgactTCCAGCCTCAGATTTCCGATTTCGGGCTCGCCAAGTGGCTG
CCGTCGGAGTGGACGCACCGGGCGATCGCCCCGATCGAAGGAACATTCGGGTGTTTGGCA
CCGGAGTACTACACGCATGGCATCGTCGACGAGAAGACGGACGTGTTCGCGTTCGGCGTC
TTCCTCCTGGAGATCATGACCGGGAGAAAGCCGGTGGATGGCAGCCACAAGAGCTTGCTC
AGCTGGGCGAGGCCGTTCCTGAACGAGGGGAGGATCGAGTCGCTGGTGGATCCGAGGATC
GGCGGCGACTACGACGGCGAGGAGGCGCGGCGGCTGGCGTTCGTGGCGTCGCTGTGCATC
CGCTCGTCGGCGAAGTGGAGGCCATCCATGACCGAGGTGCTGGAGCTGCTGGAAGGCGTC
GAGATCCGGCAAGAACGGTGGACGATGCCCGAGGCAGTGGAGGACGACGACGACGAGGAG
CTATGGAGATTCGATGACCTGGATGACGAAGATGACGAAGATGAAGAGGAGTTCAACACT
GCATCCCCATCTTCTTGCTCATCATCTTTGAGCAATTAG

Protein

393 aa

>Os06t0693200-01 Protein kinase, core domain containing protein.
MRPLYLRSSGSFKKLLLSISHRGAKNGNGDAAAKERYTPAAAAAAPESPRKPAWRCFSYE
EIHRATNAFHEGNLVGKGGSSEVYRGELPDGRAVAVKRLMGAWACERRERDFLAELGTVG
HARHPNVCALLGCCVDRDLYLVFHFSGRGSVSANLHDEKKAPAMGWAVRRAIAVGTARGL
EYLHKGCQRRIIHRDIKASNVLLTDDFQPQISDFGLAKWLPSEWTHRAIAPIEGTFGCLA
PEYYTHGIVDEKTDVFAFGVFLLEIMTGRKPVDGSHKSLLSWARPFLNEGRIESLVDPRI
GGDYDGEEARRLAFVASLCIRSSAKWRPSMTEVLELLEGVEIRQERWTMPEAVEDDDDEE
LWRFDDLDDEDDEDEEEFNTASPSSCSSSLSN*

5'UTR

chr06:28941271..28941507 (+ strand) : 237 bp

CDS

chr06:28941508..28941976 (+ strand) : 469 bp

chr06:28942079..28942239 (+ strand) : 161 bp

chr06:28942503..28942582 (+ strand) : 80 bp

chr06:28942668..28942803 (+ strand) : 136 bp

chr06:28942892..28943041 (+ strand) : 150 bp

chr06:28943370..28943552 (+ strand) : 183 bp

3'UTR

chr06:28943553..28943703 (+ strand) : 151 bp

FASTA

>Os06t0693200-01 class=Sequence position=chr06:28941271..28943703 (+ strand)
GTGCGTATCC CCGCGAAACG CCTCGTCGCG TTCATATTTG CTCACGGCTC GCGCGGCACT CGCGAGAGCA CCTCGGCGTT
AGTACCCATC AATGCCTCCC TCCTCCTCCT CCTCCGCCAC CACCACCAGC TCGCCGTCTC GTCTCCCTCC TCCGCTTCGC
CTCCTCTGAT CACCTCGCTC GCCGGCGACG CCGCGATCGC CACCGCACCG CAGGGCATTG TGTCGTCGAG GGGAGAGATG
AGGCCTCTGT ACCTGCGCAG CAGCGGCAGC TTCAAGAAGC TGCTCCTCTC CATCAGCCAC CGCGGCGCCA AGAACGGCAA
TGGCGACGCC GCCGCCAAGG AGAGATACAC GCCCGCCGCC GCCGCGGCGG CGCCGGAGTC GCCGCGGAAG CCGGCGTGGC
GGTGCTTCTC CTACGAGGAG ATCCACCGCG CCACGAACGC GTTCCACGAG GGCAACCTGG TGGGGAAGGG CGGGTCGTCG
GAGGTGTACC GCGGCGAGCT CCCCGACGGG CGGGCCGTGG CGGTGAAGCG GCTGATGGGC GCGTGGGCGT GCGAGCGGCG
GGAGCGCGAC TTCCTGGCGG AGCTCGGCAC GGTGGGGCAC GCGCGCCACC CCAACGTGTG CGCCCTCCTC GGCTGCTGcg
tcgaccgcga cctctacctc gtcttccact tctccggccg cggctccgtc tccgccaacc tccACGGTAC CAGCGACACG
AACGCGACAC CTAACAGCAA CAGCACGAAC GCGCCGCCAT TAATGGCGTT TTGACGTTTC TTGATTTGAT TTGATTGCTG
CATCGCAGAC GAGAAGAAGG CGCCGGCGAT GGGGTGGGCG GTGCGGCGCG CCATTGCCGT Cggcacggcg agggggctgg
agtacctgca caaggggtgc cagaggagga tcatccacag ggacatcaag gcatccaacg tgcttctcac cgacgactTC
CAGCCTCAGG TCAgtctctt cggagacatc cgataaaatt ggaacgatac aacaaagatt agcatggcca ctacgcaagg
atgacacgca caaatggaga aataatccaa atttttttaG GAGCTGTATT TTTCTCATGC TATATTTAAT GAATAAGCAC
AATCTTGTGC TGGTTCCGTT CAAAAAAAAA AAGGCGCATC TCATCCACCA CATTTCCATT TTTTCCTCAC CTCCTCTGTT
TCAATTGACA TGAACTGATC GTATTATCAC AGATTTCCGA TTTCGGGCTC GCCAAGTGGC TGCCGTCGGA GTGGACGCAC
CGGGCGATCG CCCCGATCGA AGGAACATTC GGGTAAAGAT TTCTGTGCTC ATGGTCGAGT CGAATTCTTG CTGGGTTTGA
CGGTGAATTT TGGCTGAAAT GACATGGTTT CTTCCAGGTG TTTGGCACCG GAGTACTACA CGCATGGCAT CGTCGACGAG
AAGACGGACG TGTTCGCGTT CGGCGTCTTC CTCCTGGAGA TCATGACCGG GAGAAAGCCG GTGGATGGCA GCCACAAGAG
CTTGCTCAGC TGGGTAATTC AGCATTCGCG ATCAGTATAA CTACTGTTTG ATCACTGAAA AATTCTGAAA CTGTCACTGA
ATTGTGACCC TGCACTTGCA GGCGAGGCCG TTCCTGAACG AGGGGAGGAT CGAGTCGCTG GTGGATCCGA GGATCGGCGG
CGACTACGAC GGCGAGGAGG CGCGGCGGCT GGCGTTCGTG GCGTCGCTGT GCATCCGCTC GTCGGCGAAG TGGAGGCCAT
CCATGACCGA GGTAACAAAC ATGATTGGTC ACACTCTGTT CCTTGATCAG AAGGCAACGA ACGCTTGCCC ATTTCTCAAG
TAGGATTGCT GCGATGGAAC ACTACATTGC TTTACCTACT TGCAAATATT TTTTTCATCA GCATGGTTAG CATTTCCATG
TAAACAGTCA TAATTTAGGG CAGAGATTCA TGACAGGGTG CCCCCCAAGC ACATGTCTCC ATGTAGCAGT AACCCACAAA
CTACTCCTTT GATGATGTTG CTTGGTTTAC GTGTAACAAC ACAAGTAATT TGCAACAGCA CTACTAGTAA TGTAGGCCAT
AAATTGGTTG TGGTAGCAGG TGCTGGAGCT GCTGGAAGGC GTCGAGATCC GGCAAGAACG GTGGACGATG CCCGAGGCAG
TGGAGGACGA CGACGACGAG GAGCTATGGA GATTCGATGA CCTGGATGAC GAAGATGACG AAGATGAAGA GGAGTTCAAC
ACTGCATCCC CATCTTCTTG CTCATCATCT TTGAGCAATT AGTAGTTAGT AATAGTATCT AAGATTGTGA GTAAGCTTGT
GATGTTGTTA CAAGATGAAA TTTTTGATAG TTACTCTCCA CTGGGCCCAC TTGTAAATAG AAAGGATTTT CATCTTATCA
TCATCCAACA GGCTATGAAA AGCAAGTAGT ACC

Locus: Os06g0693200

Loading...

Locus: Os06g0693200

Loading...