Os06t0693200-02

Locus

Os06g0693200

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK216

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 216

Oryzabase Gene Symbol Synonym(s)

OsRLCK216, OsRRK1, RRK1

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 216, Rop-interacting receptor-like kinase 1

Transcript Evidence

AK059727 (DDBJ, Best hit)

Protein Evidence

Q01KL6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Full-length cDNA

006-201-C12 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0693200-02)

RiceXPro (AK059727)

Others

Oryzabase (18912)

KEGG (Os06t0693200-02)

Transcript

1064 bp

>Os06t0693200-02 Hypothetical conserved gene.
GTTAGTACCCATCAATGCCTCCCTCCTCCTCCTCCTCCGCCACCACCACCAGCTCGCCGT
CTCGTCTCCCTCCTCCGCTTCGCCTCCTCTGATCACCTCGCTCGCCGGCGACGCCGCGAT
CGCCACCGCACCGCAGGGCATTGTGTCGTCGAGGGGAGAGATGAGGCCTCTGTACCTGCG
CAGCAGCGGCAGCTTCAAGAAGCTGCTCCTCTCCATCAGCCACCGCGGCGCCAAGAACGG
CAATGGCGACGCCGCCGCCAAGGAGAGATACACGCCCGCCGCCGCCGCGGCGGCGCCGGA
GTCGCCGCGGAAGCCGGCGTGGCGGTGCTTCTCCTACGAGGAGATCCACCGCGCCACGAA
CGCGTTCCACGAGGGCAACCTGGTGGGGAAGGGCGGGTCGTCGGAGGTGTACCGCGGCGA
GCTCCCCGACGGGCGGGCCGTGGCGGTGAAGCGGCTGATGGGCGCGTGGGCGTGCGAGCG
GCGGGAGCGCGACTTCCTGGCGGAGCTCGGCACGGTGGGGCACGCGCGCCACCCCAACGT
GTGCGCCCTCCTCGGCTGCTGcgtcgaccgcgacctctacctcgtcttccacttctccgg
ccgcggctccgtctccgccaacctccACGGTACCAGCGACACGAACGCGACACCTAACAG
CAACAGCACGAACGCGCCGCCATTAATGGCGTTTTGACGTTTCTTGATTTGATTTGATTG
CTGCATCGCAGACGAGAAGAAGGCGCCGGCGATGGGGTGGGCGGTGCGGCGCGCCATTGC
CGTCggcacggcgagggggctggagtacctgcacaaggggtgccagaggaggatcatcca
cagggacatcaaggcatccaacgtgcttctcaccgacgactTCCAGCCTCAGGTCAgtct
cttcggagacatccgataaaattggaacgatacaacaaagattagcatggccactacgca
aggatgacacgcacaaatggagaaataatccaaatttttttaGGAGCTGTATTTTTCTCA
TGCTATATTTAATGAATAAGCACAATCTTGTGCTGGTTCCGTTC

CDS

537 bp

>Os06t0693200-02 Hypothetical conserved gene.
ATGAGGCCTCTGTACCTGCGCAGCAGCGGCAGCTTCAAGAAGCTGCTCCTCTCCATCAGC
CACCGCGGCGCCAAGAACGGCAATGGCGACGCCGCCGCCAAGGAGAGATACACGCCCGCC
GCCGCCGCGGCGGCGCCGGAGTCGCCGCGGAAGCCGGCGTGGCGGTGCTTCTCCTACGAG
GAGATCCACCGCGCCACGAACGCGTTCCACGAGGGCAACCTGGTGGGGAAGGGCGGGTCG
TCGGAGGTGTACCGCGGCGAGCTCCCCGACGGGCGGGCCGTGGCGGTGAAGCGGCTGATG
GGCGCGTGGGCGTGCGAGCGGCGGGAGCGCGACTTCCTGGCGGAGCTCGGCACGGTGGGG
CACGCGCGCCACCCCAACGTGTGCGCCCTCCTCGGCTGCTGcgtcgaccgcgacctctac
ctcgtcttccacttctccggccgcggctccgtctccgccaacctccACGGTACCAGCGAC
ACGAACGCGACACCTAACAGCAACAGCACGAACGCGCCGCCATTAATGGCGTTTTGA

Protein

179 aa

>Os06t0693200-02 Hypothetical conserved gene.
MRPLYLRSSGSFKKLLLSISHRGAKNGNGDAAAKERYTPAAAAAAPESPRKPAWRCFSYE
EIHRATNAFHEGNLVGKGGSSEVYRGELPDGRAVAVKRLMGAWACERRERDFLAELGTVG
HARHPNVCALLGCCVDRDLYLVFHFSGRGSVSANLHGTSDTNATPNSNSTNAPPLMAF*

5'UTR

chr06:28941348..28941507 (+ strand) : 160 bp

CDS

chr06:28941508..28942044 (+ strand) : 537 bp

3'UTR

chr06:28942045..28942411 (+ strand) : 367 bp

FASTA

>Os06t0693200-02 class=Sequence position=chr06:28941348..28942411 (+ strand)
GTTAGTACCC ATCAATGCCT CCCTCCTCCT CCTCCTCCGC CACCACCACC AGCTCGCCGT CTCGTCTCCC TCCTCCGCTT
CGCCTCCTCT GATCACCTCG CTCGCCGGCG ACGCCGCGAT CGCCACCGCA CCGCAGGGCA TTGTGTCGTC GAGGGGAGAG
ATGAGGCCTC TGTACCTGCG CAGCAGCGGC AGCTTCAAGA AGCTGCTCCT CTCCATCAGC CACCGCGGCG CCAAGAACGG
CAATGGCGAC GCCGCCGCCA AGGAGAGATA CACGCCCGCC GCCGCCGCGG CGGCGCCGGA GTCGCCGCGG AAGCCGGCGT
GGCGGTGCTT CTCCTACGAG GAGATCCACC GCGCCACGAA CGCGTTCCAC GAGGGCAACC TGGTGGGGAA GGGCGGGTCG
TCGGAGGTGT ACCGCGGCGA GCTCCCCGAC GGGCGGGCCG TGGCGGTGAA GCGGCTGATG GGCGCGTGGG CGTGCGAGCG
GCGGGAGCGC GACTTCCTGG CGGAGCTCGG CACGGTGGGG CACGCGCGCC ACCCCAACGT GTGCGCCCTC CTCGGCTGCT
Gcgtcgaccg cgacctctac ctcgtcttcc acttctccgg ccgcggctcc gtctccgcca acctccACGG TACCAGCGAC
ACGAACGCGA CACCTAACAG CAACAGCACG AACGCGCCGC CATTAATGGC GTTTTGACGT TTCTTGATTT GATTTGATTG
CTGCATCGCA GACGAGAAGA AGGCGCCGGC GATGGGGTGG GCGGTGCGGC GCGCCATTGC CGTCggcacg gcgagggggc
tggagtacct gcacaagggg tgccagagga ggatcatcca cagggacatc aaggcatcca acgtgcttct caccgacgac
tTCCAGCCTC AGGTCAgtct cttcggagac atccgataaa attggaacga tacaacaaag attagcatgg ccactacgca
aggatgacac gcacaaatgg agaaataatc caaatttttt taGGAGCTGT ATTTTTCTCA TGCTATATTT AATGAATAAG
CACAATCTTG TGCTGGTTCC GTTC

Locus: Os06g0693200

Loading...

Locus: Os06g0693200

Loading...