Os06t0695600-01

Locus

Os06g0695600

Description

RING E3 ligase, Negative regulator for salt-stress response

RAP-DB Gene Symbol Synonym(s)

OsMAR1

RAP-DB Gene Name Synonym(s)

microtubule-associated RING finger protein 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFP, OsMAR1, MAR1

Oryzabase Gene Name Synonym(s)

RING finger protein, microtubule-associated RING nger protein 1

Transcript Evidence

AK066069

Protein Evidence

Q5Z8H4

Literature

PMID: 29260397

Note

Manual Curation

December 22, 2017

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J013058N02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0695600-01)

RiceXPro (AK066069)

Others

Oryzabase (21157)

KEGG (Os06t0695600-01)

Transcript

2646 bp

>Os06t0695600-01 RING E3 ligase, Negative regulator for salt-stress response
GTCGTCTCCATTTCCGCCTCGCGAGGAAGAAGAGAGAGAGAGAGGGCAAAGGTCGTCGCC
GCCGCCGCCGCCGCCTTCGCCGCCGTTTGGTCTCGTCGCCTTCCGGACCACCCGCACTAG
CCCTTCTCCCTCCTCGCGCGCGCACGCGCCACACGGCCGACGACGACGAGCAGGTTTGGA
GGGCCGACGCCGACGCGGCCGGCCTCCTTACGGGTCCCGTCGTCTCTGCGGCGGCTGCGC
CGATATCCATCTCACGAGCAGAGCAGGAGTAGGGAGCAGgagcaggggaggggggcgccg
tcgtcgggctgagtcccgAACTTTAGCACAAGTTGTACTAGAGAAGATATACATCTCCTT
GTGCTGTACTCTGTTTTGGTATGGAGGAAGATTCTGGTAGATCAATATCAACAACTGGTT
TTCTTAGAAGAGGCTCTAGTGTCTCCTTAAAAGATCAAGGCAATGAGGAGAGGCCAAACA
AGACAAAACTCAACCCAATGAATGCCAGGTGGGCTGACAGTAAGGAGAAGCCAAGATATT
TACGTGAGCCATTTCGTTCATCAGGCACTAAGGCTGCATGTCCAAGCTCTTCAAAAGCTC
CCGTCAGAAAATATTTCGAGGAAAAACAAGGACGGACATTTTTAGGAGAGGCAGATAATG
CAGAAAGTAGTAGCAGAAGAACTGAGGCCAACCGTCTGCAGTGTAGCAAGAAAGCTGTTG
TTGAGGAGGATGTGCATCCATATGGTCAGCAGGATGAGCCAGAAGATTTGTTGTCCACAT
CAACTACTGAAGATCAGCCTGCAGAACTTGATCCTGAACTATTAGATTCTTCTGTTTCTT
CAGGGGTGTCTGCACATGCAATTGGTTCTGTAGTCAGAAATGCTGCTTTGAGATCTAAAT
CACGTCAGCAGAAGGGTAAAGAAGAATTGTGTCAGATTAGACCTCAAACTGCTTCTGCTT
TTGTTAATCGGTCCACTATACCTCGAAATTCTACCAATGGTGTGAAATCATCAAATGCTG
CTGGCCCTGGGGTACAGAGACGTACTCTAAAAAACCTTGGCTGCACATCAATATCTGATG
TTTTGCCTTCTGGCTGTTCTTCAGCTAATTCTATTCATAATAAGAGGGCTGAGGTTATGA
GAAACAGGGCATTTGACGGAGAGAGTTCTTCTAGACCAAGGGGCTTAAATGGACACTCTA
GTTTAGGCCATTCACCTGCCATGTATTCTGGTATCACTGGTCCTAGAGTCAGAACTGCTG
AACAATCAGCTTCTCAGCAAACACGGACTAGTAGCAGAAGTATTCAGGAGTCTGCAGATT
CTTCAAGGATTAGGCGACCTTCTACTCAGCATGCCAGAGTAAGggtgccaaatgaaaggg
aggatagcgtgtttgctcttcgtgaaactcttgcaagggatcgccaaccagaatgggctc
atttctccttgggtgaagctgccccacggagatcgatgaggcctttttctatggaattac
cacatgagatatactcatctagtcgtcaaggctcaagtaatcagacagcaaggagcagat
caagttaccgccctgacgaaagccctccacaaatgtttCATGGTTTGCTGGTGGAGAGAG
AGAACTACAGGCGTATAAACATGGAAGGCATCGCTGAGgtgttgctagcattggacagga
ttgaacaagatgatgaattgacttatgagcaattgctggtgctagaaactaacttgtttc
ttagcggccttggcctgcatgaccagcacagagatatgagaatggatattgacaacatgt
cttatgaggaactattagcactagaggagcgaatcggttctgtcagcactgccctatctg
atgagcagCTTGTGAAGTGTCTCAAGCGAAATGTGTATAAGTTACCAAATTCAGATCTTG
AAGCGAACAGAGCTGTACTAGATGACGCCAAGTGCAGCATATGTCAGGAGGAATACATTG
AGGGCGAAGAAGTTGGTAGGATGCAGTGTGAGCATCAATACCATGTGTCCTGCATTCATG
AATGGCTTAGACAGAAGAACTGGTGTCCAATATGCAAAACTTCAGCAATACCTTCAGAGA
TGGACAAGGGGGGCACATGAATATAGGTTGTTCAAGCTCGTAAATATTATAAATTTATAA
TGAAACAGTGTTAGACATGCTAGACACTGACTCAATTCACTCAAATTTGTGAATATGATA
GATTGCTTTCTTCTTGGAAACTCCTGTACATTTTTGTTTCGGTATCCGGTCCAAATTACA
CATCACCTGCCATCAGATAATGAGACCAGAGGACCCTTGGGAAAAATTCCTGCTTGATTG
GACTTATGGTTACAATAATTAAAATTCTGCTCGATTGGAGTGTTAGTAAAAATTCATTCA
CTTTGGCCCCCAACCACATATTAGATTTGCAATTACTGATTTGGTGTCCAGTGTTTCAGG
TGCTTTGTAGCCTGGTTTGAGTTTGGAGTGTTCGTAAGGTGTTATCTGTTGGGTTGGTAC
TCGGATGTGTACTCTTCCTTGGGTATCAATGTAATAAGGCAAAGCTTTTGCCTTTGTCTC
AAAAAAAGGATTTGCAATTTCCTTGATCTTAATGAAATTTGGTCAGCACCCTTTCGCCGA
CCCGGC

CDS

1740 bp

>Os06t0695600-01 RING E3 ligase, Negative regulator for salt-stress response
ATGGAGGAAGATTCTGGTAGATCAATATCAACAACTGGTTTTCTTAGAAGAGGCTCTAGT
GTCTCCTTAAAAGATCAAGGCAATGAGGAGAGGCCAAACAAGACAAAACTCAACCCAATG
AATGCCAGGTGGGCTGACAGTAAGGAGAAGCCAAGATATTTACGTGAGCCATTTCGTTCA
TCAGGCACTAAGGCTGCATGTCCAAGCTCTTCAAAAGCTCCCGTCAGAAAATATTTCGAG
GAAAAACAAGGACGGACATTTTTAGGAGAGGCAGATAATGCAGAAAGTAGTAGCAGAAGA
ACTGAGGCCAACCGTCTGCAGTGTAGCAAGAAAGCTGTTGTTGAGGAGGATGTGCATCCA
TATGGTCAGCAGGATGAGCCAGAAGATTTGTTGTCCACATCAACTACTGAAGATCAGCCT
GCAGAACTTGATCCTGAACTATTAGATTCTTCTGTTTCTTCAGGGGTGTCTGCACATGCA
ATTGGTTCTGTAGTCAGAAATGCTGCTTTGAGATCTAAATCACGTCAGCAGAAGGGTAAA
GAAGAATTGTGTCAGATTAGACCTCAAACTGCTTCTGCTTTTGTTAATCGGTCCACTATA
CCTCGAAATTCTACCAATGGTGTGAAATCATCAAATGCTGCTGGCCCTGGGGTACAGAGA
CGTACTCTAAAAAACCTTGGCTGCACATCAATATCTGATGTTTTGCCTTCTGGCTGTTCT
TCAGCTAATTCTATTCATAATAAGAGGGCTGAGGTTATGAGAAACAGGGCATTTGACGGA
GAGAGTTCTTCTAGACCAAGGGGCTTAAATGGACACTCTAGTTTAGGCCATTCACCTGCC
ATGTATTCTGGTATCACTGGTCCTAGAGTCAGAACTGCTGAACAATCAGCTTCTCAGCAA
ACACGGACTAGTAGCAGAAGTATTCAGGAGTCTGCAGATTCTTCAAGGATTAGGCGACCT
TCTACTCAGCATGCCAGAGTAAGggtgccaaatgaaagggaggatagcgtgtttgctctt
cgtgaaactcttgcaagggatcgccaaccagaatgggctcatttctccttgggtgaagct
gccccacggagatcgatgaggcctttttctatggaattaccacatgagatatactcatct
agtcgtcaaggctcaagtaatcagacagcaaggagcagatcaagttaccgccctgacgaa
agccctccacaaatgtttCATGGTTTGCTGGTGGAGAGAGAGAACTACAGGCGTATAAAC
ATGGAAGGCATCGCTGAGgtgttgctagcattggacaggattgaacaagatgatgaattg
acttatgagcaattgctggtgctagaaactaacttgtttcttagcggccttggcctgcat
gaccagcacagagatatgagaatggatattgacaacatgtcttatgaggaactattagca
ctagaggagcgaatcggttctgtcagcactgccctatctgatgagcagCTTGTGAAGTGT
CTCAAGCGAAATGTGTATAAGTTACCAAATTCAGATCTTGAAGCGAACAGAGCTGTACTA
GATGACGCCAAGTGCAGCATATGTCAGGAGGAATACATTGAGGGCGAAGAAGTTGGTAGG
ATGCAGTGTGAGCATCAATACCATGTGTCCTGCATTCATGAATGGCTTAGACAGAAGAAC
TGGTGTCCAATATGCAAAACTTCAGCAATACCTTCAGAGATGGACAAGGGGGGCACATGA

Protein

580 aa

>Os06t0695600-01 RING E3 ligase, Negative regulator for salt-stress response
MEEDSGRSISTTGFLRRGSSVSLKDQGNEERPNKTKLNPMNARWADSKEKPRYLREPFRS
SGTKAACPSSSKAPVRKYFEEKQGRTFLGEADNAESSSRRTEANRLQCSKKAVVEEDVHP
YGQQDEPEDLLSTSTTEDQPAELDPELLDSSVSSGVSAHAIGSVVRNAALRSKSRQQKGK
EELCQIRPQTASAFVNRSTIPRNSTNGVKSSNAAGPGVQRRTLKNLGCTSISDVLPSGCS
SANSIHNKRAEVMRNRAFDGESSSRPRGLNGHSSLGHSPAMYSGITGPRVRTAEQSASQQ
TRTSSRSIQESADSSRIRRPSTQHARVRVPNEREDSVFALRETLARDRQPEWAHFSLGEA
APRRSMRPFSMELPHEIYSSSRQGSSNQTARSRSSYRPDESPPQMFHGLLVERENYRRIN
MEGIAEVLLALDRIEQDDELTYEQLLVLETNLFLSGLGLHDQHRDMRMDIDNMSYEELLA
LEERIGSVSTALSDEQLVKCLKRNVYKLPNSDLEANRAVLDDAKCSICQEEYIEGEEVGR
MQCEHQYHVSCIHEWLRQKNWCPICKTSAIPSEMDKGGT*

5'UTR

chr06:29063463..29063780 (- strand) : 318 bp

chr06:29062643..29062704 (- strand) : 62 bp

CDS

chr06:29061365..29062642 (- strand) : 1278 bp

chr06:29061157..29061207 (- strand) : 51 bp

chr06:29060967..29061065 (- strand) : 99 bp

chr06:29060672..29060830 (- strand) : 159 bp

chr06:29060231..29060383 (- strand) : 153 bp

3'UTR

chr06:29059705..29060230 (- strand) : 526 bp

FASTA

>Os06t0695600-01 class=Sequence position=chr06:29059705..29063780 (- strand)
GTCGTCTCCA TTTCCGCCTC GCGAGGAAGA AGAGAGAGAG AGAGGGCAAA GGTCGTCGCC GCCGCCGCCG CCGCCTTCGC
CGCCGTTTGG TCTCGTCGCC TTCCGGACCA CCCGCACTAG CCCTTCTCCC TCCTCGCGCG CGCACGCGCC ACACGGCCGA
CGACGACGAG CAGGTTTGGA GGGCCGACGC CGACGCGGCC GGCCTCCTTA CGGGTCCCGT CGTCTCTGCG GCGGCTGCGC
CGATATCCAT CTCACGAGCA GAGCAGGAGT AGGGAGCAGg agcaggggag gggggcgccg tcgtcgggct gagtcccggt
gagcatccgc atcctctctt tctctcattc atctctccgt gactctgtcc caccacccac ttttgtcttg aatttttgct
tgcgtgcgtt aaccctagct gcttcgcttc tagatctggg agaagttttt ttctcttaat ttcagagcct taaccttaat
acaagtaaca gtttgtttcc cccaaaaaaa tttttggggt tcaactgaaT TGAACCTCCA TTTTATGGTG TTATGATCAG
CTAAATTCCG AGTCATAATA TGGCAATCGA TGCTGCTATA CAATTTTTGG TCAGTATAAC TGTGTCATTC TGTGATAATT
TTAATTGGCT GGATGATATA AGTCGCAAGG CAATTGGCAC TTTTTTTCAC TGTTCCTCAT TGTGGGAAAC AAAAATAATA
TTATTATAAC AAGTATACGC GTCACTTTTT TTTCCCTTTT TGATAAGCTA AAAAAGAAAG AAAGAAATGA AATTGTGGAG
ACAGACCTTG TAGCAATAGC AATGCAATGC AATTTTAGAA ATTCAGAAGA GGGAATGTAA CTATGGCTCT CATGCATGGA
GTGGAGTAAA ATGTTGACAA TAACTAACAG TAGGTGTGAA GGTGATATAA CCTTCTTCAC ATTTTCTCAC CTCAACTGTA
TCACTTCTAG ATACGCTGCT TTCATGTATG TCTAGGTTTC CATTCTTATT ATTTTGCGGA AACATTAGTT CTGTGGTGTT
GTTGGTTTCC TAACCTTTAA AAACTTGTGG TTGCAGAACT TTAGCACAAG TTGTACTAGA GAAGATATAC ATCTCCTTGT
GCTGTACTCT GTTTTGGTAT GGAGGAAGAT TCTGGTAGAT CAATATCAAC AACTGGTTTT CTTAGAAGAG GCTCTAGTGT
CTCCTTAAAA GATCAAGGCA ATGAGGAGAG GCCAAACAAG ACAAAACTCA ACCCAATGAA TGCCAGGTGG GCTGACAGTA
AGGAGAAGCC AAGATATTTA CGTGAGCCAT TTCGTTCATC AGGCACTAAG GCTGCATGTC CAAGCTCTTC AAAAGCTCCC
GTCAGAAAAT ATTTCGAGGA AAAACAAGGA CGGACATTTT TAGGAGAGGC AGATAATGCA GAAAGTAGTA GCAGAAGAAC
TGAGGCCAAC CGTCTGCAGT GTAGCAAGAA AGCTGTTGTT GAGGAGGATG TGCATCCATA TGGTCAGCAG GATGAGCCAG
AAGATTTGTT GTCCACATCA ACTACTGAAG ATCAGCCTGC AGAACTTGAT CCTGAACTAT TAGATTCTTC TGTTTCTTCA
GGGGTGTCTG CACATGCAAT TGGTTCTGTA GTCAGAAATG CTGCTTTGAG ATCTAAATCA CGTCAGCAGA AGGGTAAAGA
AGAATTGTGT CAGATTAGAC CTCAAACTGC TTCTGCTTTT GTTAATCGGT CCACTATACC TCGAAATTCT ACCAATGGTG
TGAAATCATC AAATGCTGCT GGCCCTGGGG TACAGAGACG TACTCTAAAA AACCTTGGCT GCACATCAAT ATCTGATGTT
TTGCCTTCTG GCTGTTCTTC AGCTAATTCT ATTCATAATA AGAGGGCTGA GGTTATGAGA AACAGGGCAT TTGACGGAGA
GAGTTCTTCT AGACCAAGGG GCTTAAATGG ACACTCTAGT TTAGGCCATT CACCTGCCAT GTATTCTGGT ATCACTGGTC
CTAGAGTCAG AACTGCTGAA CAATCAGCTT CTCAGCAAAC ACGGACTAGT AGCAGAAGTA TTCAGGAGTC TGCAGATTCT
TCAAGGATTA GGCGACCTTC TACTCAGCAT GCCAGAGTAA Gggtgccaaa tgaaagggag gatagcgtgt ttgctcttcg
tgaaactctt gcaagggatc gccaaccaga atgggctcat ttctccttgg gtgaagctgc cccacggaga tcgatgaggc
ctttttctat ggaattacca catgagatat actcatctag tcgtcaaggc tcaagtaatc agacagcaag gagcagatca
agttaccgcc ctgacgaaag ccctccacaa atgtttCATG GTTTGCTGGT GGAGAGAGAG AACTACAGGC GTATAAACAT
GGAAGGCATC GCTGAGGTTG TTTTCCAGAA ACTTGTAACA TACTTGTCTG AGTTGTCATA CTGTGCCTAC ATTTTGTTTG
GGATGAAATT TACTAAATAT CATATATTTG CAATATACTG TATTCTATTG GCTGCTACAG TTTCTTGATA TTTggtgtga
ttcctgtttt caggtgttgc tagcattgga caggattgaa caagatgatg aattgactta tgaggttagt tctttgactt
gattcccttt tttcaatttt attgctaaca tggtactgaa atgtgctctg gccttctgga tgaaaatatt ggcagcaatt
gctggtgcta gaaactaact tgtttcttag cggccttggc ctgcatgacc agcacagaga tatgagaatg gatattgaca
acatgtctta tgaggtattg ctttcaccat gttgattctt cctcaaaggt tcaattagaa tatctctttc cttaacaaag
aagtgtcatc ggctcatctg attctgacat cagaaggtta tgtattttct tctgcttttc atttgctcag gaactattag
cactagagga gcgaatcggt tctgtcagca ctgccctatc tgatgagcag CTTGTGAAGT GTCTCAAGCG AAATGTGTAT
AAGTTACCAA ATTCAGATCT TGAAGCGAAC AGAGCTGTAC TAGATGACGC CAAGTGCAGC ATATGTCAGG TATTACTCAG
AGATTGTCAT CTCTGTTGCA CACGATGTTA ATTAATATAA TTCATGATTA CTTAGGGTGC ACAATAAAGC AAAGGAAAAT
AGGAGTATTA TGTTGAGGAA AATTATGTTT AGCTTCATGT TTTCTCAGCT CTACAATTTT TCTTATTTTG TTTTCTATAT
GTCCCGTTCA TTAGCCATTT TAATGCACAT GCTGTACTTA TTTTACGTTA GACAACTATT TCCTTGTGTT GCTTATGCTT
CTAATTGGCA CTGTTTGATA TTAACGTTAT GCTACAGGAG GAATACATTG AGGGCGAAGA AGTTGGTAGG ATGCAGTGTG
AGCATCAATA CCATGTGTCC TGCATTCATG AATGGCTTAG ACAGAAGAAC TGGTGTCCAA TATGCAAAAC TTCAGCAATA
CCTTCAGAGA TGGACAAGGG GGGCACATGA ATATAGGTTG TTCAAGCTCG TAAATATTAT AAATTTATAA TGAAACAGTG
TTAGACATGC TAGACACTGA CTCAATTCAC TCAAATTTGT GAATATGATA GATTGCTTTC TTCTTGGAAA CTCCTGTACA
TTTTTGTTTC GGTATCCGGT CCAAATTACA CATCACCTGC CATCAGATAA TGAGACCAGA GGACCCTTGG GAAAAATTCC
TGCTTGATTG GACTTATGGT TACAATAATT AAAATTCTGC TCGATTGGAG TGTTAGTAAA AATTCATTCA CTTTGGCCCC
CAACCACATA TTAGATTTGC AATTACTGAT TTGGTGTCCA GTGTTTCAGG TGCTTTGTAG CCTGGTTTGA GTTTGGAGTG
TTCGTAAGGT GTTATCTGTT GGGTTGGTAC TCGGATGTGT ACTCTTCCTT GGGTATCAAT GTAATAAGGC AAAGCTTTTG
CCTTTGTCTC AAAAAAAGGA TTTGCAATTT CCTTGATCTT AATGAAATTT GGTCAGCACC CTTTCGCCGA CCCGGC

Locus: Os06g0695600

Loading...

Locus: Os06g0695600

Loading...