Os06t0698900-01

Locus

Os06g0698900

Description

Similar to GATA transcription factor 25.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA20

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 20

Oryzabase Gene Symbol Synonym(s)

OsTIFY2b, TIFY2B, OsCCT24, OsGATA20

Oryzabase Gene Name Synonym(s)

TIFY GENE 2B, TIFY-DOMAIN PROTEIN 2B, CCT domain-containing gene 24, CCT (CO, CO-LIKE and TOC1) domain protein 24, CCT domain protein 24, GATA transcription factor 20, GATA factor 20

Transcript Evidence

AK243334 (DDBJ, Best hit)

Protein Evidence

NP_001148559.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

Tify (IPR010399)

CCT domain (IPR010402)

Zinc finger, NHR/GATA-type (IPR013088)

Full-length cDNA

J100058P16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0698900-01)

Others

Oryzabase (15742)

Transcript

1201 bp

>Os06t0698900-01 Similar to GATA transcription factor 25.
GATGCGGCGGCGCACGTCGCGCCCACGGTCGACCACCTCGCCGCGGTGGCCGCCGAGGCC
GAGGCGATGGCCCGCTTCGAGGAGGAGCACCGCGCCCTGGGGGCGGAGGAGGAGTATGAG
GAGGAGGAGGATGAGTTGGAGGAGGAGGAGGAGGAGATGGAGGAGGATGAGGACGCGCAA
CATCATGAGGGGGTGGGCGGCGAGGTGGCTGTCCCGATGGACGCGGAGGCCGCCGCGCAG
CTGGACCCGCACGGCGGGATGCTCGCCGCCTCCGGCGCTGTCCAGCCCATGGCGTCCAAC
CAACTCACCCTCTCGTTCCAGGGCGAGGTCTACGTCTTCGACTCTGTCTCCCCTGACAAG
GTTCAAGCAGTGCTCTTGCTACTCGGTGGAAGGGAGCTGAACCCAGGTTTGGGCTCTGGA
GCATCGTCATCTGCGCCATACAGTAAGAGGTTGAATTTTCCACACCGGGTGGCATCTTTG
ATGCGGTTCAGAGAAAAGCGGAAGGAGCGCAACTTTGATAAGAAGATCCGGTATTCTGTT
CGGAAGGAAGTTGCACTTAGGATGCAGCGCAATAGAGGTCAGTTTACATCTTCAAAACCA
AAGGGTGATGAAGCAACATCGGAATTGACAGCTTCAGATGGCTCCCCAAACTGGGGATCA
GTGGAAGGTCGGCCTCCCTCTGCTGCTGAATGCCATCACTGTGGTATAAATGCAAAGGCT
ACACCTATGATGCGTCGTGGACCTGATGGGCCAAGAACATTATGCAATGCCTGTGGCCTC
ATGTGGGCAAACAAGGGGATGTTGAGGGACCTATCAAAAGCACCTCCCACACCTATTCAA
GTTGTGGCATCAGTTAATGATGGTAATGGAAGTGCTGCAGCACCTACCACCGAGCAAGAA
ATTCCTGCACCAGCCACTGTCAATGGCCACGAATCATCAACGTGAGTATAGCGATGTTTG
TCTTGTGGAGGATCGCGAACATCATGCCGGCATTATATCCATGTAGTTTAACTGTCTGTA
CTATAACTTGATGAGAACCTGTTAGGTACCTAGGCCATTTCTTTACCATCATTTAGGGTT
TGAATGTTGTTCTGCATATGTTGTAAGCCATGAAAAATCATGCTTCCGGTCATTATGGCC
GTAGCAATTTTATTTCTTGTTAGACTCTTGGGTGGAAGTGAGAACAGAGAAGGTGATGAA
G

CDS

879 bp

>Os06t0698900-01 Similar to GATA transcription factor 25.
ATGGCCCGCTTCGAGGAGGAGCACCGCGCCCTGGGGGCGGAGGAGGAGTATGAGGAGGAG
GAGGATGAGTTGGAGGAGGAGGAGGAGGAGATGGAGGAGGATGAGGACGCGCAACATCAT
GAGGGGGTGGGCGGCGAGGTGGCTGTCCCGATGGACGCGGAGGCCGCCGCGCAGCTGGAC
CCGCACGGCGGGATGCTCGCCGCCTCCGGCGCTGTCCAGCCCATGGCGTCCAACCAACTC
ACCCTCTCGTTCCAGGGCGAGGTCTACGTCTTCGACTCTGTCTCCCCTGACAAGGTTCAA
GCAGTGCTCTTGCTACTCGGTGGAAGGGAGCTGAACCCAGGTTTGGGCTCTGGAGCATCG
TCATCTGCGCCATACAGTAAGAGGTTGAATTTTCCACACCGGGTGGCATCTTTGATGCGG
TTCAGAGAAAAGCGGAAGGAGCGCAACTTTGATAAGAAGATCCGGTATTCTGTTCGGAAG
GAAGTTGCACTTAGGATGCAGCGCAATAGAGGTCAGTTTACATCTTCAAAACCAAAGGGT
GATGAAGCAACATCGGAATTGACAGCTTCAGATGGCTCCCCAAACTGGGGATCAGTGGAA
GGTCGGCCTCCCTCTGCTGCTGAATGCCATCACTGTGGTATAAATGCAAAGGCTACACCT
ATGATGCGTCGTGGACCTGATGGGCCAAGAACATTATGCAATGCCTGTGGCCTCATGTGG
GCAAACAAGGGGATGTTGAGGGACCTATCAAAAGCACCTCCCACACCTATTCAAGTTGTG
GCATCAGTTAATGATGGTAATGGAAGTGCTGCAGCACCTACCACCGAGCAAGAAATTCCT
GCACCAGCCACTGTCAATGGCCACGAATCATCAACGTGA

Protein

293 aa

>Os06t0698900-01 Similar to GATA transcription factor 25.
MARFEEEHRALGAEEEYEEEEDELEEEEEEMEEDEDAQHHEGVGGEVAVPMDAEAAAQLD
PHGGMLAASGAVQPMASNQLTLSFQGEVYVFDSVSPDKVQAVLLLLGGRELNPGLGSGAS
SSAPYSKRLNFPHRVASLMRFREKRKERNFDKKIRYSVRKEVALRMQRNRGQFTSSKPKG
DEATSELTASDGSPNWGSVEGRPPSAAECHHCGINAKATPMMRRGPDGPRTLCNACGLMW
ANKGMLRDLSKAPPTPIQVVASVNDGNGSAAAPTTEQEIPAPATVNGHESST*

5'UTR

chr06:29370301..29370366 (- strand) : 66 bp

CDS

chr06:29370007..29370300 (- strand) : 294 bp

chr06:29369808..29369894 (- strand) : 87 bp

chr06:29369586..29369698 (- strand) : 113 bp

chr06:29368770..29368898 (- strand) : 129 bp

chr06:29368282..29368387 (- strand) : 106 bp

chr06:29367353..29367421 (- strand) : 69 bp

chr06:29366295..29366375 (- strand) : 81 bp

3'UTR

chr06:29366039..29366294 (- strand) : 256 bp

FASTA

>Os06t0698900-01 class=Sequence position=chr06:29366039..29370366 (- strand)
GATGCGGCGG CGCACGTCGC GCCCACGGTC GACCACCTCG CCGCGGTGGC CGCCGAGGCC GAGGCGATGG CCCGCTTCGA
GGAGGAGCAC CGCGCCCTGG GGGCGGAGGA GGAGTATGAG GAGGAGGAGG ATGAGTTGGA GGAGGAGGAG GAGGAGATGG
AGGAGGATGA GGACGCGCAA CATCATGAGG GGGTGGGCGG CGAGGTGGCT GTCCCGATGG ACGCGGAGGC CGCCGCGCAG
CTGGACCCGC ACGGCGGGAT GCTCGCCGCC TCCGGCGCTG TCCAGCCCAT GGCGTCCAAC CAACTCACCC TCTCGTTCCA
GGGCGAGGTC TACGTCTTCG ACTCTGTCTC CCCTGACAAG GTCGTTTGCC TCTCATGCGC TTGGCCTTGT TTGTTTGTCA
TGTGTGTTTC GGTATAGACT GGGATTGATG TTGCAAAAAA AAAAAGGCTG AGTGTTCGAT TACTTCTCGC AGGTTCAAGC
AGTGCTCTTG CTACTCGGTG GAAGGGAGCT GAACCCAGGT TTGGGCTCTG GAGCATCGTC ATCTGCGCCA TACAGTAAGG
TTGGCACGGG TGATGGTGAA CTGTCTTTCT TTGTAGTATC AGTTCATTAT GTTTGACAGG ATTGTGCACT CTGGAGTTCA
TTGTGTATTT TTTTTCCCTT GGTTTCAGAG GTTGAATTTT CCACACCGGG TGGCATCTTT GATGCGGTTC AGAGAAAAGC
GGAAGGAGCG CAACTTTGAT AAGAAGATCC GGTATTCTGT TCGGAAGGAA GTTGCACTTA GGTTGGTGCT AGCTTAGCAT
TGGCTGTGGA TGTTTATACG TACTGAAATG CTATAGAATT TTGTTCCTAT TTGAATGCTG ATTGACCTGA ATTAGGAAGA
GTCAAGCGTG CTGTATTTGA TCTGTGAGTA ATACACTCTG CTAACAATGT ACTTAATATA GTGGAAGTGA ACTGAATAAT
ATAATCTAAA CTTGGCAACT TATACATTGT ATTTGTACCA AAAGCGTGTT TTAGTTTTGA GTTGTCTGGC TGCTTTTATT
AAGCTATTct ccctctgttt catattgtaa gtcgttctga cttttttcgt agtcaaactt cttcaagttt aaccaagttt
atagacaaat ttagcaacat gtacaacacc aaattagttt tgttagaact aacatttaca atattttgat aataagtttg
ttttgtgttg aaaatattgc tatattttta tataaactta gtcaaactta aagatcaaag tatcagtgtc aaagcgactt
ataatatgaa acggaggtag taCCTTTTTA AGTATCAGTG TCTTTCTTGT GGTTACTTTC AGTTTTGATA TTACCGTGGC
AGATAGTAGG ATTTATATTT TGCTGTTATT CATGTTTTCT AAATTACCTC TGCTTAGATT ATGTACAGGA AATCTTCATA
GTTTAAAATA TTTTCTATGT ATGTGTAGGA TGCAGCGCAA TAGAGGTCAG TTTACATCTT CAAAACCAAA GGGTGATGAA
GCAACATCGG AATTGACAGC TTCAGATGGC TCCCCAAACT GGGGATCAGT GGAAGGTCGG CCTCCCTCTG CTGCTGAGTA
AGTAGAGAAA AATCCCATTT TTTTTGGTTC TTGGTTTATG ACTTTTCCAG CAATATTTCT TGATGTGTGA AACATCCTTT
ACATATTTAT TAGCAAGGTG TTGACAATCA ATCCATGCTT GGAATCGTGT GCTCTAGTGT ATTGCATTGT ATAGATGCTA
TGAACTGTGG ATCAATCCCA TTTTTTACTT GGCTAACTTT AGTTGAACAA TTTGCATGTA AGTTTGATAT AGATATCTTT
GTTATACTTA TCATACATGC AAATATGCTT CTTTTTTGTA TGGTGTATGC CAGGTTATTA CTACCTTTTT ATCATTGTGG
TTTCTCTAAG CATATGAAAC ATCATTTATA AATTTTGGTG ATTGCTATTT TTTTTTCAGA TGCCATCACT GTGGTATAAA
TGCAAAGGCT ACACCTATGA TGCGTCGTGG ACCTGATGGG CCAAGAACAT TATGCAATGC CTGTGGCCTC ATGTGGGCAA
ACAAGGTACC TATAAATGTT TAGTAGTACC ATTGCATAGC TAGATTTAAG TCAGCATAGA AACTCAAGAG TTATAACTTA
TAAGTCAAAC TTTGTGATAG ATCATAGATG TAGCAAAATA TTATAACTTC TAAGAACTGA AGACCGACTT AATATTAAGA
TTCTATCAGC AATTTTTTGC TAGGATCATT TTTGTTGAAA TTGTTTAAGT TACATTATTA ATTTGCACTT TATAAGCTAT
TATCGTGACA TATTTAAAGC ACCAGTTACT CACACTTGTC TTGACTTATT TCTATGTATA TCTATATATG CAATTGAAGG
TTAAAATGCC AAGTTCAAGG TGTCATGCCA ACTTGGTATG CAGTTTGTTA TTTGAGTATA GGTTGTTGGG ATGAGTTTTG
TTGAAGTTTC TAGTATACAA TCCAATGCAA TGAAGTTAGA TGCATGGTGC TGATGTTTGA ATATGTAATC TATTTAGTGA
GTTCTGTCTG TTCTTGAACA AGTTTCACAC TATCATTAAT ATTAGTCTTA ACAATCTGAT GTGCTTCCTG GTGCATGGAA
AGTTTCATAG CTGAGCATTT TGTTAATTGG CAATAAGAGT TTTAAACTTT ATTTGTTGAC AAACACAGGA AATTGTTGGT
AATCCATAAT CCAAATCCAT AAATGGTCTG TTATACACTT ACACTGAAAG CATGGGTCTT TTAAACTATG CTTCACATTG
CTTTCTCTTT CTGTTTGTTT TTAGTAATCC ATACATCAAG TGATCAAAGT ACTTAGATCT TATCTTTAAA TTTTTGACAC
CTTACCTCAT AAATGTGGAA TCTCTGTTTT TCTACTAAAA ACAAATCTCT TTTTTTTTTT TGTAGGGGAT GTTGAGGGAC
CTATCAAAAG CACCTCCCAC ACCTATTCAA GTTGTGGCAT CAGTTAATGA TGGTGTAAGT CATTTTCCCC CATTAGCTGC
ACATCTATTT ACATACTTTT TGAGGATTCT AATTTTCACA ATAAGTTGAA AGTGAAATGA CTCTTTGGCT CAGATGAGTT
GAATCCTTGT TTCGTTATCT AGCTTACTGA TGATTGTAGC CATTTTTAAG CAGTTGCTGA AAATTTTGGA GAAATTAATC
AAAATATTGG TCCACAATGG CTTCTCAATA TTTTCTTAAC TTTTATGAAG GTAAATCAAG TTATGGTCCA TTGCCAGGGG
ATTAAAAAAC TGTGGCTCTA GCTATTCCAT TCTAAATTTG AGGATATTAG ATAGTGTGAT ATACTGATAT TGTTTCCTGT
TATACTGGTC ACTGGTGTGA CTGGTTGACT TTCAATCCAT AGTTGTAAAC TTAAAATCAT GACACATAAT TGGTTTAGCT
ATGGGAAGAT TTAATGCTGA CGGTTGGGCA TCTTTGCATG TTATTTTCTT CTCTCCTTGG TATTCAAAAT ATGAAAGCTG
TCCTATAACT GTGGCTTTTG TTTACTGCCG GTTAAATATG AACTTGTTTT CCTTTATTTG CACTGGCAGC CTGAGGCTAG
CTTCAGCATC AATATACTGT AGTTTACATT TGTTTCTGAC GGCAGTATGG CTTATAATga tgtggccatt taagaatttt
aggggttgtt ttgttttgag gaattggatg gccaatggac catcagatac tcccaagtct cacttttttg ttcggttcga
ggaatggaat gtgttggtcc ataaccacct catccctcga tatgtgattg attCCTCGAA AGAAACAGCC TAAGTTATGG
CCCATTTCAG GCATCAAGTA TAATGTCCTA AAAGTTTCTG TATCCTGTTA CAACCAACAA ATTCTCTTTT CCGGTCTCTG
TAGCTTCTTC AATATGCCTT GATATTTCAA ACAAATCAAT TTTTGAAGCT TCTGCTACTT TTCCTCCACA GAATGGAAGT
GCTGCAGCAC CTACCACCGA GCAAGAAATT CCTGCACCAG CCACTGTCAA TGGCCACGAA TCATCAACGT GAGTATAGCG
ATGTTTGTCT TGTGGAGGAT CGCGAACATC ATGCCGGCAT TATATCCATG TAGTTTAACT GTCTGTACTA TAACTTGATG
AGAACCTGTT AGGTACCTAG GCCATTTCTT TACCATCATT TAGGGTTTGA ATGTTGTTCT GCATATGTTG TAAGCCATGA
AAAATCATGC TTCCGGTCAT TATGGCCGTA GCAATTTTAT TTCTTGTTAG ACTCTTGGGT GGAAGTGAGA ACAGAGAAGG
TGATGAAG

Locus: Os06g0698900

Loading...

Locus: Os06g0698900

Loading...