Os06t0700700-01

Locus

Os06g0700700

Description

Similar to P1B-type heavy metal transporting ATPase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HMA2

CGSNL Gene Name

HEAVY METAL ATPASE 2

Oryzabase Gene Symbol Synonym(s)

OsHMA2, osHMA2, OsHMA2v

Oryzabase Gene Name Synonym(s)

heavy metal ATPase 2, heavy metal transporter 2, heavy metal P-Type ATPase 2, heavy metal P1B-ATPase 2, Zn/ Cd-transporting ATPase 2

Transcript Evidence

AK107235 (DDBJ, Best hit)

Protein Evidence

E7EC32 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metal ion transport (GO:0030001)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Heavy metal-associated domain, HMA (IPR006121)

Full-length cDNA

002-125-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0700700-01)

RiceXPro (AK107235)

Others

Oryzabase (9914)

KEGG (Os06t0700700-01 (EC:3.6.3.3, EC:3.6.3.5))

Transcript

1753 bp

>Os06t0700700-01 Similar to P1B-type heavy metal transporting ATPase.
CTATCCCCGATTCGCACAGCCAATCTCTTCTTGCTTCCTCCTCCTCCTCCTCCAGCCGCC
GCCGCCGACGACGATTCTTGGTAGAGAGATTCTTGCGTTGTTTTACCTGCGTCTTGTTCT
TCTTGGGAGTTGGGTGGATCGATTGATCGAGGTTTTGGAGGTTGGAAGAAGTGTGTGTTG
TGGTGGGGGGTTTGTAGAGAGAGAGAGGGCAAAGGCACGCAAAGAGGGAGAGAGTGAGGA
GAGATGGCGGCGGAGGGAGGGAGGTGTCAGAAGAGCTACTTCGACGTGCTGGGGATTTGC
TGCCCGTCGGAGGTTCCCCTCGTCGAGAAGCTTCTGCAGCCGCTGGAGGGCGTCCAGAAG
GTCACCGTGATCGTTCCCTCCAGGACGGTCATCGTCGTCCACGACGTCGACGCCATCTCC
CAATCCCAAATCGTCAAGGCGCTGAATCAGGCAAGGTTGGAGGCGTCGGTTCGGGCTTAT
GGGAACGGCAGTGAGAAGATCACCAACAAATGGCCGAGCCCGTATGTTCTCCTCTGCGGA
CTTCTTCTGGTCGTGTCGCTGTTCGAGCATTTCTGGCACCCGCTCAAGTGGTTCGCGCTG
GTGGCTGCGGCCGCCGGCTTGCCGCCGATCGTGCTGAGGAGCATTGCGGCCATCCGGAGA
CTCACCCTGGATGTCAACATACTCATGCTGATTGCTGGTAAGAACAGCCTATAATTCACC
TGTGACATTAATGATGTTTCCTGTTATTGGTACCTTGAAAAAAAAAGAAGCTCCCTTTTG
TTGGAGGATGGCCCTGACCATCACCTCCGACGATCGAAGACCCTTTGATCTTTAGGAGAT
AACTGAATTATAAAATTTTAAATAGGCTTCCTTCATCTGGTGGCCTAATGCATGCATTTT
GGCTTGTACCAAAACCTACTTTCTCTCTTTAATGAAATGAAAAGCAGAGGTCCCACCATA
CTTTTTGAAAAGAAATGAACGTTTAAATAGTATCGAATGGTAGCAAACACATCTGCCATT
AAGGATATCCTCCAATTGAATAGTCTCATTTGAAATAAGAAAACAAATTATTGACACAGC
TTAGTAGTAGAGCATTGAGTTTTAACGTTGATGCCATGGGTTTGAAGCTTTTTTTTCTGT
ATTAAAAGGGCAACAGTATACTTGTTCCTTTTTTTACCATAGTATTCTCTTGTGTGTAGA
AGACACAAATACAACACCACTTTGGGTAAATATTCAACTACGGATTGAAGTTGTGGGTAT
TATTGATACCTGTTCTACCAGTGTGACAATGGGTTGTGAAAAAAAAAGAGACAAAAGCAA
GTTTCTTCACGAGGACCAATATGGTGGGTGATTAGTGGGAGAGCAGAAGCAGAAATCCAT
CTCTCAAAAGTTTATGTCTCACTTGCATAAACTTTTGCTTTCTTTTCTTTTCTAGAGGGT
CCCTCACTTTCCATCACATCAAAAGGATATGTTGCTGTGATGCTAATATACGTGCTAGAT
GAACAATTCTGCTTCTTTTCCTCCATGTGGCGATGTCACCTCAGATAGGGCATCAGATTC
CTTTTAGAACAAGCAACATATTTCTTATCAAGAAGCTACACATATTTCGAATAATTCTTT
CTAGACTAATATCGTGGCATTGAGATAGCTCTATTGTGATATGCATATGGGAATATGGGA
TACATGAAAGAATCATCAAAAGAAACAAGAAATACCTTGTTTCAAAAAGAAAAAAAGATT
TGGAAGATTTGGT

CDS

471 bp

>Os06t0700700-01 Similar to P1B-type heavy metal transporting ATPase.
ATGGCGGCGGAGGGAGGGAGGTGTCAGAAGAGCTACTTCGACGTGCTGGGGATTTGCTGC
CCGTCGGAGGTTCCCCTCGTCGAGAAGCTTCTGCAGCCGCTGGAGGGCGTCCAGAAGGTC
ACCGTGATCGTTCCCTCCAGGACGGTCATCGTCGTCCACGACGTCGACGCCATCTCCCAA
TCCCAAATCGTCAAGGCGCTGAATCAGGCAAGGTTGGAGGCGTCGGTTCGGGCTTATGGG
AACGGCAGTGAGAAGATCACCAACAAATGGCCGAGCCCGTATGTTCTCCTCTGCGGACTT
CTTCTGGTCGTGTCGCTGTTCGAGCATTTCTGGCACCCGCTCAAGTGGTTCGCGCTGGTG
GCTGCGGCCGCCGGCTTGCCGCCGATCGTGCTGAGGAGCATTGCGGCCATCCGGAGACTC
ACCCTGGATGTCAACATACTCATGCTGATTGCTGGTAAGAACAGCCTATAA

Protein

156 aa

>Os06t0700700-01 Similar to P1B-type heavy metal transporting ATPase.
MAAEGGRCQKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDVDAISQ
SQIVKALNQARLEASVRAYGNGSEKITNKWPSPYVLLCGLLLVVSLFEHFWHPLKWFALV
AAAAGLPPIVLRSIAAIRRLTLDVNILMLIAGKNSL*

5'UTR

chr06:29480717..29480905 (- strand) : 189 bp

chr06:29480486..29480539 (- strand) : 54 bp

CDS

chr06:29480296..29480485 (- strand) : 190 bp

chr06:29478988..29479268 (- strand) : 281 bp

3'UTR

chr06:29477949..29478987 (- strand) : 1039 bp

FASTA

>Os06t0700700-01 class=Sequence position=chr06:29477949..29480905 (- strand)
CTATCCCCGA TTCGCACAGC CAATCTCTTC TTGCTTCCTC CTCCTCCTCC TCCAGCCGCC GCCGCCGACG ACGATTCTTG
GTAGAGAGAT TCTTGCGTTG TTTTACCTGC GTCTTGTTCT TCTTGGGAGT TGGGTGGATC GATTGATCGA GGTTTTGGAG
GTTGGAAGAA GTGTGTGTTG TGGTGGGGGG TAAGTGAGAT GGAGAACTGA ATTCACTGAA CTCATTTTCT TTCCTTTTTT
TTTTGGTCTG ACAAGAAGTA AAAATTCCTG AACCTGAAAC CAACCAAAGG ACAGGTTGGT CGACACGCCA AGATTGCTTT
TGCTGCTGTG TCCTTCTCAC TCTTGTTCTT GTTCTTGCTT CTTCAGGTTT GTAGAGAGAG AGAGGGCAAA GGCACGCAAA
GAGGGAGAGA GTGAGGAGAG ATGGCGGCGG AGGGAGGGAG GTGTCAGAAG AGCTACTTCG ACGTGCTGGG GATTTGCTGC
CCGTCGGAGG TTCCCCTCGT CGAGAAGCTT CTGCAGCCGC TGGAGGGCGT CCAGAAGGTC ACCGTGATCG TTCCCTCCAG
GACGGTCATC GTCGTCCACG ACGTCGACGC CATCTCCCAA TCCCAAATCG GTGAGAGCCC CCCTTTTTTC TTTTTTGCTT
TCCGAGTGGA TTGATTCATC TCCCTTTCGT GATTAAGATC GATCTCTCCT TCCATCTTGA CTTGTCACTT ATCATTGTCC
TGTGATCAAT GAATGATACC AATCATGCAA CCGGTGACTG AGCCATCTTG TGGGATTTGT GGAGTTTTTG GGTGGGTCAA
GAAGTCACAC GAGACTAGAC CAGACCAGAG TCTCAGTAAT TTGAAGAAAA CGATCTTTTT TATTTTCTTT GTCATGGCTG
CTTGTTTGTT CATTGGATTT TCGATGATTT TATTTCTGTT CTTGCTAGTT TAATCAGAAT CTTACTTTAA TTATCGCAAG
AAAAATTGGA TCTTAACATA TATATAGCGT GTTGAGCGAT GGAAAGCATC ACGCAAAGTT GCTTGCGTTT CTCATTCTGT
TCTTGCTGTT CATGAGTTGT TCCAGTATCT GTATTTTTTT TTTGTTTGTT TGTTTGTTTG TTCACAATAA ATTTCATTTC
TAATCGTTGC TTGATTCAAT AACTAGCCAG CCAAGCAAAG GTGGTGTCAT GTGTTCGTTT GTTTTCATGG CTCGAGGCTG
GGGACCACTT ACCATGTCAG AAAATAAGTG CAAAATTTCA TACTCCAACT CTACTAAAAT GGGATGTTTG CTAGCGACAA
GTGAACCGTC TTGGCAGTGG TCGCTATTGT TCATGACGCA GGGAGCAATT ACTGATACGA TTGGACATAT CTCTTGACTC
GTTAATTCTG ACCTCAGCAC CCCCGAAATC CTGCTAATTT TGCAGTTTCT GTCACGAGAA TTAAGGAACT TGATTACTGT
ACAATACTGT CACACTCAAT GAAACCGCCA GTTTTTCATC TTTGGTTCTT GAAACAGTCA TTACATAATT TTAGATAAAT
GTTACTGTCC TTGAGGAGGT ATACCAATTA TGACAGATGG ACAGTAAAAT CAATCACGAT TTTAGCATGA CAAAACTCTT
GAAAGCTTGA TTTGATTTTG ATATTTGCTG TTTTCAGTCA AGGCGCTGAA TCAGGCAAGG TTGGAGGCGT CGGTTCGGGC
TTATGGGAAC GGCAGTGAGA AGATCACCAA CAAATGGCCG AGCCCGTATG TTCTCCTCTG CGGACTTCTT CTGGTCGTGT
CGCTGTTCGA GCATTTCTGG CACCCGCTCA AGTGGTTCGC GCTGGTGGCT GCGGCCGCCG GCTTGCCGCC GATCGTGCTG
AGGAGCATTG CGGCCATCCG GAGACTCACC CTGGATGTCA ACATACTCAT GCTGATTGCT GGTAAGAACA GCCTATAATT
CACCTGTGAC ATTAATGATG TTTCCTGTTA TTGGTACCTT GAAAAAAAAA GAAGCTCCCT TTTGTTGGAG GATGGCCCTG
ACCATCACCT CCGACGATCG AAGACCCTTT GATCTTTAGG AGATAACTGA ATTATAAAAT TTTAAATAGG CTTCCTTCAT
CTGGTGGCCT AATGCATGCA TTTTGGCTTG TACCAAAACC TACTTTCTCT CTTTAATGAA ATGAAAAGCA GAGGTCCCAC
CATACTTTTT GAAAAGAAAT GAACGTTTAA ATAGTATCGA ATGGTAGCAA ACACATCTGC CATTAAGGAT ATCCTCCAAT
TGAATAGTCT CATTTGAAAT AAGAAAACAA ATTATTGACA CAGCTTAGTA GTAGAGCATT GAGTTTTAAC GTTGATGCCA
TGGGTTTGAA GCTTTTTTTT CTGTATTAAA AGGGCAACAG TATACTTGTT CCTTTTTTTA CCATAGTATT CTCTTGTGTG
TAGAAGACAC AAATACAACA CCACTTTGGG TAAATATTCA ACTACGGATT GAAGTTGTGG GTATTATTGA TACCTGTTCT
ACCAGTGTGA CAATGGGTTG TGAAAAAAAA AGAGACAAAA GCAAGTTTCT TCACGAGGAC CAATATGGTG GGTGATTAGT
GGGAGAGCAG AAGCAGAAAT CCATCTCTCA AAAGTTTATG TCTCACTTGC ATAAACTTTT GCTTTCTTTT CTTTTCTAGA
GGGTCCCTCA CTTTCCATCA CATCAAAAGG ATATGTTGCT GTGATGCTAA TATACGTGCT AGATGAACAA TTCTGCTTCT
TTTCCTCCAT GTGGCGATGT CACCTCAGAT AGGGCATCAG ATTCCTTTTA GAACAAGCAA CATATTTCTT ATCAAGAAGC
TACACATATT TCGAATAATT CTTTCTAGAC TAATATCGTG GCATTGAGAT AGCTCTATTG TGATATGCAT ATGGGAATAT
GGGATACATG AAAGAATCAT CAAAAGAAAC AAGAAATACC TTGTTTCAAA AAGAAAAAAA GATTTGGAAG ATTTGGT

Locus: Os06g0700700

Loading...

Locus: Os06g0700700

Loading...