Os06t0700700-02

Locus

Os06g0700700

Description

P-Type heavy metal ATPase, Delivery of Zinc to developing tissues

RAP-DB Gene Symbol Synonym(s)

HMA2, OsHMA2, osHMA2

RAP-DB Gene Name Synonym(s)

HEAVY METAL ATPASE 2, heavy metal ATPase 2, heavy metal transporter 2, heavy metal P-Type ATPase 2

CGSNL Gene Symbol

HMA2

CGSNL Gene Name

HEAVY METAL ATPASE 2

Oryzabase Gene Symbol Synonym(s)

OsHMA2, osHMA2, OsHMA2v

Oryzabase Gene Name Synonym(s)

heavy metal ATPase 2, heavy metal transporter 2, heavy metal P-Type ATPase 2, heavy metal P1B-ATPase 2, Zn/ Cd-transporting ATPase 2

Transcript Evidence

AB697186

Protein Evidence

A3BF39

Literature

PMID: 23575418

Note

Manual Curation

March 7, 2014

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: metal ion transport (GO:0030001)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: cation-transporting ATPase activity (GO:0019829)

Molecular Function: metal ion binding (GO:0046872)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Cation-transporting P-type ATPase (IPR001757)

Cation-transporting P-type ATPase, subfamily IB (IPR027256)

Heavy metal-associated domain, HMA (IPR006121)

P-type ATPase, A domain (IPR008250)

HAD-like domain (IPR023214)

P-type ATPase, cytoplasmic domain N (IPR023299)

P-type ATPase, phosphorylation site (IPR018303)

Others

Oryzabase (9914)

Transcript

3204 bp

>Os06t0700700-02 P-Type heavy metal ATPase, Delivery of Zinc to developing tissues
ATGGCGGCGGAGGGAGGGAGGTGTCAGAAGAGCTACTTCGACGTGCTGGGGATTTGCTGC
CCGTCGGAGGTTCCCCTCGTCGAGAAGCTTCTGCAGCCGCTGGAGGGCGTCCAGAAGGTC
ACCGTGATCGTTCCCTCCAGGACGGTCATCGTCGTCCACGACGTCGACGCCATCTCCCAA
TCCCAAATCGTCAAGGCGCTGAATCAGGCAAGGTTGGAGGCGTCGGTTCGGGCTTATGGG
AACGGCAGTGAGAAGATCACCAACAAATGGCCGAGCCCGTATGTTCTCCTCTGCGGACTT
CTTCTGGTCGTGTCGCTGTTCGAGCATTTCTGGCACCCGCTCAAGTGGTTCGCGCTGGTG
GCTGCGGCCGCCGGCTTGCCGCCGATCGTGCTGAGGAGCATTGCGGCCATCCGGAGACTC
ACCCTGGATGTCAACATACTCATGCTGATTGCTGTTGCTGGAGCAATAGCTCTCAAGGAC
TATTCTGAGGCTGGGTTCATCGTCTTCCTCTTCACTACAGCTGAATGGCTTGAGACTAGG
GCCAGCCACAAGGCCACCGCTGGGATGTCAGCTCTAATGAGCATGGCACCACAAAAGGCT
ATTCTGGCAGAGACCGGGGAGGTGGTTGCAGCCCGGGATGTGAAGGTCAATACAGTAATT
GCTGTCAAGGCAGGGGAAGTCATTCCAATCGACGGTGTTGTTGTTGATGGACGTAGTGAG
GTCGACGAGAGCACCCTCACGGGGGAGTCCTTCCCAGTGTCCAAGCAGCCAGACTCCCAG
GTCTGGGCTGGCACACTCAACATTGACGGTTACATTGCTGTGAGGACGACTGCTATGGCT
GACAACTCCGCGGTGGCCAAAATGGCAAGGTTGGTTGAAGAAGCACAAAACAGCAGATCC
AGTACACAGAGGCTGATCGACACGTGTGCTAAGTATTACACACCTGCGGTCGTTGTCATG
GCAGGATCAGTAGCAGCAATTCCTGCAATAGCGAAAGCACATAACCTTAAGCACTGGTTC
CAATTGGCTCTAGTTCTTCTAGTGAGTGCTTGTCCATGTGCACTGGTACTGTCCACACCC
ATTGCCACCTTCTGCGCGCTACTAAGGGCCGCAAGGACAGGGCTGCTCATCAAAGGAGGA
GATGTCCTGGAATCCTTGGCTAGCATCAAAGTTGCAGCTTTTGACAAAACTGGTACAATT
ACTAGAGGAGAGTTCAGTGTTGAGGAGTTCCAGCCAGTTGGTGAACGTGTTTCATTGCAA
CAACTTCTTTACTGGGTCTCGAGCGTTGAGAGCAGATCAAGTCACCCCATGGCATCTGTC
CTGGTTGATTATGCTCAATCAAAGTCTGTGGAACCAAAATCAGAGAATGTTAGTGAATTC
CAAATATATCCTGGTGAGGGGATTTATGGTGAAATCGACGGAGCAGGCATATATATTGGG
AACAAAAGAATTTTGTCAAGAGCTTCATGCGAAACAGTTCCGGACATGAAAGATATGAAA
GGAGTTACCATTGGATATGTGGCATGTAACAATGAATTGATTGGAGTATTCACTCTATCG
GATGCCTGCCGAACTGGATCAGCTGAGGCCATCAAGGAACTGAGATCACTGGGCATTAAG
TCAGTGATGCTTACAGGTGATAGTAGCGCTGCTGCCACATATGCACAGAATCAGCTGGGA
AATATCCTTGCTGAGGTTCATGCTGAACTTCTTCCAGAGGACAAAGTGAGAATTGTTGGT
GAACTCAAGGAAAAAGATGGCCCTACGCTGATGGTTGGTGATGGCATGAATGATGCCCCG
GCATTGGCTAAAGCTGATGTTGGAGTCTCTATGGGTGTATCTGGTTCAGCTGTTGCAATG
GAGACAAGCCACGTTGCTCTGATGTCAAATGACATCCGCAGGATTCCAAAGGCTGTCCGG
CTGGCAAGGAGGACGCATCGGACAATCATCGTGAACATCATATTCTCGGTGATTACGAAG
CTTGCAATCGTTGGGCTTGCATTTGCCGGACATCCACTTATCTGGGCAGCCGTCCTTGCA
GATGTTGGCACATGCTTGCTGGTGATCATGTACAGCATGCTGTTGCTGAGAGAGAAGGAC
AGTCGAAAGGCGAAGAAATGTGCTGCTTCTCATCACGGATCTCCAAAGAAGTGCTGTTCT
TCTTCTCATCATGGATCTCATGCAAAGAAAAATCATGGCGTTTCCCACCATTGTTCGGAT
GGTCCGTGCAAATCAATGGTCAGTTGCAAAGAATCATCAGTTGCAAAGAATGCTTGTCAT
GATCACCACCATGAGCATAACCATCACGAAGAGCCAGCCCACAAGCATTCTTCGAACCAG
CATGGTTGCCATGATCACAGCCATGGCCATAGCAACTGCAAAGAGCCAAGCAACCAGCTG
ATTACAAACAAGCATGCTTGCCATGATGGTCATAACCACTGCGCAGATACGAGCAATCTG
CACGACACCAAGAAGCATGACTGCCATGGCCATGAGCATAGCACCTGCAAAGAAGAACTC
AACGCTTTGCCTCCCACCAATGACCATGCTTGCCATGGCCATGAACATAGCCACTGTGAA
GAACCCGTTGCTCTGCACTCTACCGGCGAACATGCTTGCCATGAGCATGAGCATGAGCAT
ATCCACTGTGACGAGCCAATCGGCTCGCATTGCGCTGATAAGCATGCTTGCCATGACCAT
GAACAGGTTCATGAGCATCATTGCTGTGATGAACAGCAAACTCCGCACACCGCAGATTTG
CACCCCTGCCATGACCATGACCATGACAACCTGGAGGTCGAGGAAGTAAAGGACTGCCAT
GCTGAACCACCTCACCACCACAACCATTGCTGCCATGAACCTCATGATCAGGTCAAGAAT
GATACTCATCCAGTCCAGGAGCACTCGATCTCGATCGAAGAATCATCAGACCACCATGAG
CATCACCACAAcgaagaacacaaagccgaagattgcggacatcatccgaagccgaaagat
tgtgCTCCACCTCCAACTGACTGCATCAGCAGAAACTGTTGCAGCAATACCAGCAAAGGT
AAAGACATTTGCTCGAGCTTGCACAGGGATCATCATACCAGCCAGGCCAGCCGGTGCTGC
AGGAGCTATGTGAAATGCTCCAGGCCCAGCAGGAGTTGCTGCAGCCACAGCATAGTGAAG
CTGCCTGAGATCGTAGTGGAGTAG

CDS

3204 bp

>Os06t0700700-02 P-Type heavy metal ATPase, Delivery of Zinc to developing tissues
ATGGCGGCGGAGGGAGGGAGGTGTCAGAAGAGCTACTTCGACGTGCTGGGGATTTGCTGC
CCGTCGGAGGTTCCCCTCGTCGAGAAGCTTCTGCAGCCGCTGGAGGGCGTCCAGAAGGTC
ACCGTGATCGTTCCCTCCAGGACGGTCATCGTCGTCCACGACGTCGACGCCATCTCCCAA
TCCCAAATCGTCAAGGCGCTGAATCAGGCAAGGTTGGAGGCGTCGGTTCGGGCTTATGGG
AACGGCAGTGAGAAGATCACCAACAAATGGCCGAGCCCGTATGTTCTCCTCTGCGGACTT
CTTCTGGTCGTGTCGCTGTTCGAGCATTTCTGGCACCCGCTCAAGTGGTTCGCGCTGGTG
GCTGCGGCCGCCGGCTTGCCGCCGATCGTGCTGAGGAGCATTGCGGCCATCCGGAGACTC
ACCCTGGATGTCAACATACTCATGCTGATTGCTGTTGCTGGAGCAATAGCTCTCAAGGAC
TATTCTGAGGCTGGGTTCATCGTCTTCCTCTTCACTACAGCTGAATGGCTTGAGACTAGG
GCCAGCCACAAGGCCACCGCTGGGATGTCAGCTCTAATGAGCATGGCACCACAAAAGGCT
ATTCTGGCAGAGACCGGGGAGGTGGTTGCAGCCCGGGATGTGAAGGTCAATACAGTAATT
GCTGTCAAGGCAGGGGAAGTCATTCCAATCGACGGTGTTGTTGTTGATGGACGTAGTGAG
GTCGACGAGAGCACCCTCACGGGGGAGTCCTTCCCAGTGTCCAAGCAGCCAGACTCCCAG
GTCTGGGCTGGCACACTCAACATTGACGGTTACATTGCTGTGAGGACGACTGCTATGGCT
GACAACTCCGCGGTGGCCAAAATGGCAAGGTTGGTTGAAGAAGCACAAAACAGCAGATCC
AGTACACAGAGGCTGATCGACACGTGTGCTAAGTATTACACACCTGCGGTCGTTGTCATG
GCAGGATCAGTAGCAGCAATTCCTGCAATAGCGAAAGCACATAACCTTAAGCACTGGTTC
CAATTGGCTCTAGTTCTTCTAGTGAGTGCTTGTCCATGTGCACTGGTACTGTCCACACCC
ATTGCCACCTTCTGCGCGCTACTAAGGGCCGCAAGGACAGGGCTGCTCATCAAAGGAGGA
GATGTCCTGGAATCCTTGGCTAGCATCAAAGTTGCAGCTTTTGACAAAACTGGTACAATT
ACTAGAGGAGAGTTCAGTGTTGAGGAGTTCCAGCCAGTTGGTGAACGTGTTTCATTGCAA
CAACTTCTTTACTGGGTCTCGAGCGTTGAGAGCAGATCAAGTCACCCCATGGCATCTGTC
CTGGTTGATTATGCTCAATCAAAGTCTGTGGAACCAAAATCAGAGAATGTTAGTGAATTC
CAAATATATCCTGGTGAGGGGATTTATGGTGAAATCGACGGAGCAGGCATATATATTGGG
AACAAAAGAATTTTGTCAAGAGCTTCATGCGAAACAGTTCCGGACATGAAAGATATGAAA
GGAGTTACCATTGGATATGTGGCATGTAACAATGAATTGATTGGAGTATTCACTCTATCG
GATGCCTGCCGAACTGGATCAGCTGAGGCCATCAAGGAACTGAGATCACTGGGCATTAAG
TCAGTGATGCTTACAGGTGATAGTAGCGCTGCTGCCACATATGCACAGAATCAGCTGGGA
AATATCCTTGCTGAGGTTCATGCTGAACTTCTTCCAGAGGACAAAGTGAGAATTGTTGGT
GAACTCAAGGAAAAAGATGGCCCTACGCTGATGGTTGGTGATGGCATGAATGATGCCCCG
GCATTGGCTAAAGCTGATGTTGGAGTCTCTATGGGTGTATCTGGTTCAGCTGTTGCAATG
GAGACAAGCCACGTTGCTCTGATGTCAAATGACATCCGCAGGATTCCAAAGGCTGTCCGG
CTGGCAAGGAGGACGCATCGGACAATCATCGTGAACATCATATTCTCGGTGATTACGAAG
CTTGCAATCGTTGGGCTTGCATTTGCCGGACATCCACTTATCTGGGCAGCCGTCCTTGCA
GATGTTGGCACATGCTTGCTGGTGATCATGTACAGCATGCTGTTGCTGAGAGAGAAGGAC
AGTCGAAAGGCGAAGAAATGTGCTGCTTCTCATCACGGATCTCCAAAGAAGTGCTGTTCT
TCTTCTCATCATGGATCTCATGCAAAGAAAAATCATGGCGTTTCCCACCATTGTTCGGAT
GGTCCGTGCAAATCAATGGTCAGTTGCAAAGAATCATCAGTTGCAAAGAATGCTTGTCAT
GATCACCACCATGAGCATAACCATCACGAAGAGCCAGCCCACAAGCATTCTTCGAACCAG
CATGGTTGCCATGATCACAGCCATGGCCATAGCAACTGCAAAGAGCCAAGCAACCAGCTG
ATTACAAACAAGCATGCTTGCCATGATGGTCATAACCACTGCGCAGATACGAGCAATCTG
CACGACACCAAGAAGCATGACTGCCATGGCCATGAGCATAGCACCTGCAAAGAAGAACTC
AACGCTTTGCCTCCCACCAATGACCATGCTTGCCATGGCCATGAACATAGCCACTGTGAA
GAACCCGTTGCTCTGCACTCTACCGGCGAACATGCTTGCCATGAGCATGAGCATGAGCAT
ATCCACTGTGACGAGCCAATCGGCTCGCATTGCGCTGATAAGCATGCTTGCCATGACCAT
GAACAGGTTCATGAGCATCATTGCTGTGATGAACAGCAAACTCCGCACACCGCAGATTTG
CACCCCTGCCATGACCATGACCATGACAACCTGGAGGTCGAGGAAGTAAAGGACTGCCAT
GCTGAACCACCTCACCACCACAACCATTGCTGCCATGAACCTCATGATCAGGTCAAGAAT
GATACTCATCCAGTCCAGGAGCACTCGATCTCGATCGAAGAATCATCAGACCACCATGAG
CATCACCACAAcgaagaacacaaagccgaagattgcggacatcatccgaagccgaaagat
tgtgCTCCACCTCCAACTGACTGCATCAGCAGAAACTGTTGCAGCAATACCAGCAAAGGT
AAAGACATTTGCTCGAGCTTGCACAGGGATCATCATACCAGCCAGGCCAGCCGGTGCTGC
AGGAGCTATGTGAAATGCTCCAGGCCCAGCAGGAGTTGCTGCAGCCACAGCATAGTGAAG
CTGCCTGAGATCGTAGTGGAGTAG

Protein

1067 aa

>Os06t0700700-02 P-Type heavy metal ATPase, Delivery of Zinc to developing tissues
MAAEGGRCQKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDVDAISQ
SQIVKALNQARLEASVRAYGNGSEKITNKWPSPYVLLCGLLLVVSLFEHFWHPLKWFALV
AAAAGLPPIVLRSIAAIRRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETR
ASHKATAGMSALMSMAPQKAILAETGEVVAARDVKVNTVIAVKAGEVIPIDGVVVDGRSE
VDESTLTGESFPVSKQPDSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRS
STQRLIDTCAKYYTPAVVVMAGSVAAIPAIAKAHNLKHWFQLALVLLVSACPCALVLSTP
IATFCALLRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQPVGERVSLQ
QLLYWVSSVESRSSHPMASVLVDYAQSKSVEPKSENVSEFQIYPGEGIYGEIDGAGIYIG
NKRILSRASCETVPDMKDMKGVTIGYVACNNELIGVFTLSDACRTGSAEAIKELRSLGIK
SVMLTGDSSAAATYAQNQLGNILAEVHAELLPEDKVRIVGELKEKDGPTLMVGDGMNDAP
ALAKADVGVSMGVSGSAVAMETSHVALMSNDIRRIPKAVRLARRTHRTIIVNIIFSVITK
LAIVGLAFAGHPLIWAAVLADVGTCLLVIMYSMLLLREKDSRKAKKCAASHHGSPKKCCS
SSHHGSHAKKNHGVSHHCSDGPCKSMVSCKESSVAKNACHDHHHEHNHHEEPAHKHSSNQ
HGCHDHSHGHSNCKEPSNQLITNKHACHDGHNHCADTSNLHDTKKHDCHGHEHSTCKEEL
NALPPTNDHACHGHEHSHCEEPVALHSTGEHACHEHEHEHIHCDEPIGSHCADKHACHDH
EQVHEHHCCDEQQTPHTADLHPCHDHDHDNLEVEEVKDCHAEPPHHHNHCCHEPHDQVKN
DTHPVQEHSISIEESSDHHEHHHNEEHKAEDCGHHPKPKDCAPPPTDCISRNCCSNTSKG
KDICSSLHRDHHTSQASRCCRSYVKCSRPSRSCCSHSIVKLPEIVVE*

CDS

chr06:29480296..29480485 (- strand) : 190 bp

chr06:29479005..29479268 (- strand) : 264 bp

chr06:29477429..29477527 (- strand) : 99 bp

chr06:29476664..29476920 (- strand) : 257 bp

chr06:29476425..29476560 (- strand) : 136 bp

chr06:29475997..29476325 (- strand) : 329 bp

chr06:29475725..29475926 (- strand) : 202 bp

chr06:29475255..29475451 (- strand) : 197 bp

chr06:29473630..29475159 (- strand) : 1530 bp

FASTA

>Os06t0700700-02 class=Sequence position=chr06:29473630..29480485 (- strand)
ATGGCGGCGG AGGGAGGGAG GTGTCAGAAG AGCTACTTCG ACGTGCTGGG GATTTGCTGC CCGTCGGAGG TTCCCCTCGT
CGAGAAGCTT CTGCAGCCGC TGGAGGGCGT CCAGAAGGTC ACCGTGATCG TTCCCTCCAG GACGGTCATC GTCGTCCACG
ACGTCGACGC CATCTCCCAA TCCCAAATCG GTGAGAGCCC CCCTTTTTTC TTTTTTGCTT TCCGAGTGGA TTGATTCATC
TCCCTTTCGT GATTAAGATC GATCTCTCCT TCCATCTTGA CTTGTCACTT ATCATTGTCC TGTGATCAAT GAATGATACC
AATCATGCAA CCGGTGACTG AGCCATCTTG TGGGATTTGT GGAGTTTTTG GGTGGGTCAA GAAGTCACAC GAGACTAGAC
CAGACCAGAG TCTCAGTAAT TTGAAGAAAA CGATCTTTTT TATTTTCTTT GTCATGGCTG CTTGTTTGTT CATTGGATTT
TCGATGATTT TATTTCTGTT CTTGCTAGTT TAATCAGAAT CTTACTTTAA TTATCGCAAG AAAAATTGGA TCTTAACATA
TATATAGCGT GTTGAGCGAT GGAAAGCATC ACGCAAAGTT GCTTGCGTTT CTCATTCTGT TCTTGCTGTT CATGAGTTGT
TCCAGTATCT GTATTTTTTT TTTGTTTGTT TGTTTGTTTG TTCACAATAA ATTTCATTTC TAATCGTTGC TTGATTCAAT
AACTAGCCAG CCAAGCAAAG GTGGTGTCAT GTGTTCGTTT GTTTTCATGG CTCGAGGCTG GGGACCACTT ACCATGTCAG
AAAATAAGTG CAAAATTTCA TACTCCAACT CTACTAAAAT GGGATGTTTG CTAGCGACAA GTGAACCGTC TTGGCAGTGG
TCGCTATTGT TCATGACGCA GGGAGCAATT ACTGATACGA TTGGACATAT CTCTTGACTC GTTAATTCTG ACCTCAGCAC
CCCCGAAATC CTGCTAATTT TGCAGTTTCT GTCACGAGAA TTAAGGAACT TGATTACTGT ACAATACTGT CACACTCAAT
GAAACCGCCA GTTTTTCATC TTTGGTTCTT GAAACAGTCA TTACATAATT TTAGATAAAT GTTACTGTCC TTGAGGAGGT
ATACCAATTA TGACAGATGG ACAGTAAAAT CAATCACGAT TTTAGCATGA CAAAACTCTT GAAAGCTTGA TTTGATTTTG
ATATTTGCTG TTTTCAGTCA AGGCGCTGAA TCAGGCAAGG TTGGAGGCGT CGGTTCGGGC TTATGGGAAC GGCAGTGAGA
AGATCACCAA CAAATGGCCG AGCCCGTATG TTCTCCTCTG CGGACTTCTT CTGGTCGTGT CGCTGTTCGA GCATTTCTGG
CACCCGCTCA AGTGGTTCGC GCTGGTGGCT GCGGCCGCCG GCTTGCCGCC GATCGTGCTG AGGAGCATTG CGGCCATCCG
GAGACTCACC CTGGATGTCA ACATACTCAT GCTGATTGCT GGTAAGAACA GCCTATAATT CACCTGTGAC ATTAATGATG
TTTCCTGTTA TTGGTACCTT GAAAAAAAAA GAAGCTCCCT TTTGTTGGAG GATGGCCCTG ACCATCACCT CCGACGATCG
AAGACCCTTT GATCTTTAGG AGATAACTGA ATTATAAAAT TTTAAATAGG CTTCCTTCAT CTGGTGGCCT AATGCATGCA
TTTTGGCTTG TACCAAAACC TACTTTCTCT CTTTAATGAA ATGAAAAGCA GAGGTCCCAC CATACTTTTT GAAAAGAAAT
GAACGTTTAA ATAGTATCGA ATGGTAGCAA ACACATCTGC CATTAAGGAT ATCCTCCAAT TGAATAGTCT CATTTGAAAT
AAGAAAACAA ATTATTGACA CAGCTTAGTA GTAGAGCATT GAGTTTTAAC GTTGATGCCA TGGGTTTGAA GCTTTTTTTT
CTGTATTAAA AGGGCAACAG TATACTTGTT CCTTTTTTTA CCATAGTATT CTCTTGTGTG TAGAAGACAC AAATACAACA
CCACTTTGGG TAAATATTCA ACTACGGATT GAAGTTGTGG GTATTATTGA TACCTGTTCT ACCAGTGTGA CAATGGGTTG
TGAAAAAAAA AGAGACAAAA GCAAGTTTCT TCACGAGGAC CAATATGGTG GGTGATTAGT GGGAGAGCAG AAGCAGAAAT
CCATCTCTCA AAAGTTTATG TCTCACTTGC ATAAACTTTT GCTTTCTTTT CTTTTCTAGA GGGTCCCTCA CTTTCCATCA
CATCAAAAGG ATATGTTGCT GTGATGCTAA TATACGTGCT AGATGAACAA TTCTGCTTCT TTTCCTCCAT GTGGCGATGT
CACCTCAGAT AGGGCATCAG ATTCCTTTTA GAACAAGCAA CATATTTCTT ATCAAGAAGC TACACATATT TCGAATAATT
CTTTCTAGAC TAATATCGTG GCATTGAGAT AGCTCTATTG TGATATGCAT ATGGGAATAT GGGATACATG AAAGAATCAT
CAAAAGAAAC AAGAAATACC TTGTTTCAAA AAGAAAAAAA GATTTGGAAG ATTTGGTAAA AAAAAAAGGA AAGTGCAAAT
TTTCTTTGTC GTATGTTGAC AACATTTCTG GTTTTCTTAG TTAGGTGAAT ATATCAAATG ATTTCTGTAT ATAATGTTTT
ATTTGACACG GAAGTGAAGT GAAAAAGTGG GGTTTTATTG GTACTACTAA GAAGAAGGCA AATTGTATAT GTGAATATCT
TATATTTTAA CAAATATTAT CATGAACCAT GATTTCTATA TCCTTTTTTC GCCGGGTGAT TTCTATATCC TTTTTGGCAC
TATCTTCTTA TCTTGGATGA CCCATGCTAT CTTGCCAGCA CCTATGGGTA GATTACTTTC TACATGCCAT TAAATCCAGG
CAATTTTGGT AGGAGATGGA TGACAACACA AAACCCAGAG TTTTGTATGT CTGTACTTAC TTTTTTTGTT TGGTGCAGTT
GCTGGAGCAA TAGCTCTCAA GGACTATTCT GAGGCTGGGT TCATCGTCTT CCTCTTCACT ACAGCTGAAT GGCTTGAGAC
TAGGGCCAGC CACAAGGTCT ATTTCCATCT CTTTTAGCTA TTTTATTTTG CCTCACTATT CATGTTTGAT TGCTGAGGTC
ATGATCAGGC CACTAACCGA GAAGGATCTA TTGTTTATGA CGTGTCACAT TTATGGGCAC AAATTCATGC TAATGCAGCA
TACTGGGCCT ATAGATTTGG ATGTGCACTA GCCCCACTGA TTGGTGGACT GATGAACTGG TTGGACCAGA ATCAGGCCCA
TGTTACTCAT ATATCATCAG TTATCAGTTT ATCATCATTT TAGCATATAC CCCCACCCCA AAATTGTCAA GGGAAAGACA
AATAAACTTT TGTATCTAGT GGACTCAAAC ATGCATCTAC ACTCATAATG CGTATATAAA GCATGATCTA GGAAAGCAAG
GTGAATCTAC TAAAACAATA GTCTTCAAAA GGCAATAATA GTCAGCACAC ATGTGTATAT TGGTATTAGT TATATTTGTT
CTCTTTACTT AATCTCTGTA ATTAAATGTT CCTTTGGCAT GTAGGCCACC GCTGGGATGT CAGCTCTAAT GAGCATGGCA
CCACAAAAGG CTATTCTGGC AGAGACCGGG GAGGTGGTTG CAGCCCGGGA TGTGAAGGTC AATACAGTAA TTGCTGTCAA
GGCAGGGGAA GTCATTCCAA TCGACGGTGT TGTTGTTGAT GGACGTAGTG AGGTCGACGA GAGCACCCTC ACGGGGGAGT
CCTTCCCAGT GTCCAAGCAG CCAGACTCCC AGGTCTGGGC TGGCACACTC AACATTGACG GTAATATATG ATGAACTGTC
AGTTGATTTG ATGTCCCTGA TATGCCTAAA ATTTCAAGGT GTGCTATTGA TTCTGTATCA ATTCTGTACT GGTGATGTAT
CAGGTTACAT TGCTGTGAGG ACGACTGCTA TGGCTGACAA CTCCGCGGTG GCCAAAATGG CAAGGTTGGT TGAAGAAGCA
CAAAACAGCA GATCCAGTAC ACAGAGGCTG ATCGACACGT GTGCTAAGTA TTACACACCT GGTAAGCTAA ATAAAAGAGA
CTAGGCTTTT AGTAAAAATT TAGACACCAA AAACTTGGAT CAGGTGGGTT TCTTACTGTT TACGTTGTTT GCACCTGCAG
CGGTCGTTGT CATGGCAGGA TCAGTAGCAG CAATTCCTGC AATAGCGAAA GCACATAACC TTAAGCACTG GTTCCAATTG
GCTCTAGTTC TTCTAGTGAG TGCTTGTCCA TGTGCACTGG TACTGTCCAC ACCCATTGCC ACCTTCTGCG CGCTACTAAG
GGCCGCAAGG ACAGGGCTGC TCATCAAAGG AGGAGATGTC CTGGAATCCT TGGCTAGCAT CAAAGTTGCA GCTTTTGACA
AAACTGGTAC AATTACTAGA GGAGAGTTCA GTGTTGAGGA GTTCCAGCCA GTTGGTGAAC GTGTTTCATT GCAACAACTT
CTTTACTGGT GAGACTCGTC GAAACTTTCA CTTAAAATTT CTTCTTGTGT ATTGCATTTA ATTATATGGA TATCACAGGG
TCTCGAGCGT TGAGAGCAGA TCAAGTCACC CCATGGCATC TGTCCTGGTT GATTATGCTC AATCAAAGTC TGTGGAACCA
AAATCAGAGA ATGTTAGTGA ATTCCAAATA TATCCTGGTG AGGGGATTTA TGGTGAAATC GACGGAGCAG GCATATATAT
TGGGAACAAA AGAATTTTGT CAAGAGCTTC ATGCGAAACA GGTTGGTGAA ATTAAAAGGC TTCCTAAATG TGGTAGAACA
CTGTTGATAG TTTACGGTTA GTCACTGTTG AATTTGTTGT TAAATAAGAA AAATATCACT CCAACAGTAA ATAAAATTGT
TCTGCCTCAG GAATATTAAG TAGAACTAGT AATTGTGAAT AGAGGTTTTG CTTCACTTTC TTTTGACCAA AACATGATCT
TTGAGATATC CTGTTGAACA GTCTTGCGTT TTTGTAACTC TCATGTTTAT CTTTTTAATT TTTTTTTTTT GTAGTTCCGG
ACATGAAAGA TATGAAAGGA GTTACCATTG GATATGTGGC ATGTAACAAT GAATTGATTG GAGTATTCAC TCTATCGGAT
GCCTGCCGAA CTGGATCAGC TGAGGCCATC AAGGAACTGA GATCACTGGG CATTAAGTCA GTGATGCTTA CAGGTGATAG
TAGCGCTGCT GCCACATATG CACAGAATCA GGTAAAATAA TTTTCAGTGT GAGTGGCTGT TTTTACTGTT GTTCGGTTTT
GCATATTACA GCATCTAATT TTGCTCTTGT TTTTCTTTTC TGGCAGCTGG GAAATATCCT TGCTGAGGTT CATGCTGAAC
TTCTTCCAGA GGACAAAGTG AGAATTGTTG GTGAACTCAA GGAAAAAGAT GGCCCTACGC TGATGGTTGG TGATGGCATG
AATGATGCCC CGGCATTGGC TAAAGCTGAT GTTGGAGTCT CTATGGGTGT ATCTGGTTCA GCTGTTGCAA TGGAGACAAG
CCACGTTGCT CTGATGTCAA ATGACATCCG CAGGATTCCA AAGGCTGTCC GGCTGGCAAG GAGGACGCAT CGGACAATCA
TCGTGAACAT CATATTCTCG GTGATTACGA AGCTTGCAAT CGTTGGGCTT GCATTTGCCG GACATCCACT TATCTGGGCA
GCCGTCCTTG CAGATGTTGG CACATGCTTG CTGGTGATCA TGTACAGCAT GCTGTTGCTG AGAGAGAAGG ACAGTCGAAA
GGCGAAGAAA TGTGCTGCTT CTCATCACGG ATCTCCAAAG AAGTGCTGTT CTTCTTCTCA TCATGGATCT CATGCAAAGA
AAAATCATGG CGTTTCCCAC CATTGTTCGG ATGGTCCGTG CAAATCAATG GTCAGTTGCA AAGAATCATC AGTTGCAAAG
AATGCTTGTC ATGATCACCA CCATGAGCAT AACCATCACG AAGAGCCAGC CCACAAGCAT TCTTCGAACC AGCATGGTTG
CCATGATCAC AGCCATGGCC ATAGCAACTG CAAAGAGCCA AGCAACCAGC TGATTACAAA CAAGCATGCT TGCCATGATG
GTCATAACCA CTGCGCAGAT ACGAGCAATC TGCACGACAC CAAGAAGCAT GACTGCCATG GCCATGAGCA TAGCACCTGC
AAAGAAGAAC TCAACGCTTT GCCTCCCACC AATGACCATG CTTGCCATGG CCATGAACAT AGCCACTGTG AAGAACCCGT
TGCTCTGCAC TCTACCGGCG AACATGCTTG CCATGAGCAT GAGCATGAGC ATATCCACTG TGACGAGCCA ATCGGCTCGC
ATTGCGCTGA TAAGCATGCT TGCCATGACC ATGAACAGGT TCATGAGCAT CATTGCTGTG ATGAACAGCA AACTCCGCAC
ACCGCAGATT TGCACCCCTG CCATGACCAT GACCATGACA ACCTGGAGGT CGAGGAAGTA AAGGACTGCC ATGCTGAACC
ACCTCACCAC CACAACCATT GCTGCCATGA ACCTCATGAT CAGGTCAAGA ATGATACTCA TCCAGTCCAG GAGCACTCGA
TCTCGATCGA AGAATCATCA GACCACCATG AGCATCACCA CAAcgaagaa cacaaagccg aagattgcgg acatcatccg
aagccgaaag attgtgCTCC ACCTCCAACT GACTGCATCA GCAGAAACTG TTGCAGCAAT ACCAGCAAAG GTAAAGACAT
TTGCTCGAGC TTGCACAGGG ATCATCATAC CAGCCAGGCC AGCCGGTGCT GCAGGAGCTA TGTGAAATGC TCCAGGCCCA
GCAGGAGTTG CTGCAGCCAC AGCATAGTGA AGCTGCCTGA GATCGTAGTG GAGTAG

Locus: Os06g0700700

Loading...

Locus: Os06g0700700

Loading...