Os06t0702600-01

Locus

Os06g0702600

Description

Auxin response factor 19, Control of leaf angle

RAP-DB Gene Symbol Synonym(s)

ARF7A, OsARF7a, OsARF19

RAP-DB Gene Name Synonym(s)

AUXIN RESPONSE FACTOR 7A, auxin response factor-7a, auxin response factor 7a, auxin response factor-19, auxin response factor 19

CGSNL Gene Symbol

ARF7A

CGSNL Gene Name

AUXIN RESPONSE FACTOR 7A

Oryzabase Gene Symbol Synonym(s)

OsARF7a, OsARF19, ARF19, OsARF7

Oryzabase Gene Name Synonym(s)

auxin response factor-7a, auxin response factor 7a, auxin response factor-19, auxin response factor 19

Transcript Evidence

AK103312

Protein Evidence

Q0D9R7-2

Literature

PMID: 24995795

Note

Manual Curation

December 8, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: response to hormone (GO:0009725)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

DNA-binding pseudobarrel domain (IPR015300)

B3 DNA binding domain (IPR003340)

Auxin response factor (IPR010525)

AUX/IAA domain (IPR033389)

PB1 domain (IPR000270)

Full-length cDNA

J033125G19 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0702600-01)

RiceXPro (AK103312)

Others

Oryzabase (10000)

KEGG (Os06t0702600-01)

Transcript

3546 bp

>Os06t0702600-01 Auxin response factor 19, Control of leaf angle
CAGCATCACCACCACCCTACTCTCTCTCTCTAGCTAGGGTTGCGCTGCTTCGGTCTCGGT
CTTGGCGCCGCCTGCCTCGCCCTTCTTGCTCGCCCCTGCTCCCCTGTCCCTCTCGTGTCG
GGGCGACGGACGGACATCCTCACCCGCGCGCACGTACGGGTGATCGATCGATTGATTCCT
GCTCCGACGAAGACGGCGGCGGCGCCGGTGACCTCGCCGGACATGCGCGGGGCCCGCTGA
GGTCTTTGTTGCCGGCGAAAGGGGTGGAGTGATTGACTCGGTCGGTGTCTGCCTGTCTGG
TCTGAGGTCATGATGAAGCAGGCGCAGCAGCAGCCGCCGCCGCCACCGGCGAGCTCTGCG
GCGACGACGACCACCGCGATGGCAGCCGCTGCGGCGGCGGCGGTGGTGGGGAGCGGGTGC
GAAGGGGAGAAGACGAAGGCGCCGGCGATCAACTCGGAGCTGTGGCACGCCTGCGCGGGG
CCGCTGGTGTCGCTGCCGCCGGCGGGCAGCCTCGTCGTCTACTTCCCCCAGGGCCACAGC
GAGCAGGTTGCAGCCTCTATGCAAAAGGATGTTGATGCACATGTTCCAAGCTACCCAAAT
CTGCCTTCAAAGTTGATTTGCCTTCTGCATAACGTCACTTTACATGCGGACCCAGAAACA
GATGAAGTGTATGCACAAATGACTCTTCAGCCAGTTACTTCATATGGGAAGGAGGCCCTG
CAGTTATCAGAGCTTGCACTCAAACAAGCGAGACCACAGACAGAATTCTTTTGCAAGACA
CTGACTGCAAGTGATACAAGTACTCATGGAGGCTTCTCTGTGCCTCGTCGAGCTGCAGAA
AAGATATTTCCTCCACTGGACTTCTCAATGCAACCACCTGCACAAGAACTACAGGCCAGG
GATTTGCATGATAATGTGTGGACATTCCGTCACATATATCGGGGTCAGCCAAAAAGGCAT
CTGCTTACCACTGGCTGGAGTCTATTTGTAAGCGGCAAGAGGTTATTTGCTGGAGATTCT
GTCATTTTTGTCAGGGATGAAAAGCAGCAACTTCTATTAGGAATCAGGCGTGCTAACCGA
CAGCCAACTAACATATCATCATCTGTCCTTTCAAGTGACAGCATGCACATAGGGATTCTT
GCTGCTGCAGCCCATGCTGCTGCCAACAATAGCCCATTTACCATCTTTTATAACCCTAGG
GCCAGTCCTACTGAATTTGTTATCCCATTTGCTAAGTATCAGAAGGCAGTCTATGGTAAT
CAAATATCTTTAGGGATGCGCTTTCGCATGATGTTTGAGACTGAGGAATTAGGAACACGA
AGATACATGGGAACAATAACTGGCATAAGTGATCTAGATCCAGTAAGATGGAAAAACTCG
CAGTGGCGCAACTTACAGGTTGGTTGGGATGAATCCGCAGCCGGTGAAAGGCGAAATAGG
GTTTCTATCTGGGAGATTGAACCGGTCGCTGCTCCATTTTTCATATGTCCTCCACCATTT
TTTGGTGCGAAGCGGCCCAGGCAATTAGATGACGAGTCCTCGGAAATGGAGAATCTCTTA
AAGAGGGCTATGCCTTGGCTTGGTGAGGAAATATGCATAAAGGATCCTCAGACTCAGAAC
ACCATAATGCCTGGGCTGAGCTTGGTTCAGTGGATGAACATGAACATGCAACAGAGCTCC
TCATTTGCGAATACAGCCATGCAGTCTGAGTACCTTCGATCATTGAGCAACCCCAACATG
CAAAATCTTGGTGCCGCCGATCTCTCTAGGCAATTATGCCTGCAGAACCAGCTTCTTCAA
CAGAACAATATACAGTTTAATACTCCCAAACTTTCTCAGCAAATGCAGCCAGTCAATGAG
TTAGCAAAGGCAGGCATTCCGTTGAATCAGCTTGGTGTGAGCACCAAACCTCAGGAACAG
ATTCATGATGCTAGCAACCTTCAGAGGCAACAACCTTCCATGAACCATATGCTTCCTTTG
AGCCAAGCTCAAACCAATCTTGGCCAAGCTCAGGTCCTTGTCCAAAATCAAATGCAACAG
CAACATGCATCTTCAACTCAAGGTCAACAACCAGCTACCAGCCAGCCCTTGCTTCTGCCC
CAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAACAACAACAACAGCAACAACAACAA
AAATTGCTACAACAGCAGCAGCAACAGCTTTTGCTCCAGCAACAGCAGCAATTGAGTAAG
ATGCCTGCACAGTTGTCAAGTCTGGCGAATCAGCAGTTTCAGCTAACTGATCAACAGCTT
CAGCTGCAACTGTTACAAAAACTACAGCAACAACAGCAGTCATTGCTTTCACAACCTGCA
GTCACCCTTGCACAATTACCTCTGATCCAAGAACAGCAGAAGTTACTTCTGGATATGCAA
CAGCAGCTGTCAAACTCCCAAACACTTTCCCAACAACAAATGATGCCTCAACAAAGTACC
AAGGTTCCATCACAGAATGATGGACTTCTACATCAAAATTTCCCTATGTCCAACTTCAAC
CAGCCACAGATGTTCAAAGATGCTCCTCCTGATGCTGAAATTCATGCTGCTAATACAAGT
AACAATGCATTGTTTGGAATCAATGGTGATGGTCCGCTGGGCTTCCCTATAGGACTAGGA
ACAGATGATTTCCTGTCGAATGGAATTGATGCTGCCAAGTACGAGAACCATATCTCAACA
GAAATTGATAATAGCTACAGAATTCCGAAGGATGCCCAGCAAGAAATATCATCCTCAATG
GTTTCACAGTCATTTGGTGCATCAGATATGGCATTTAATTCAATTGATTCCACGATCAAC
GATGGTGGCTTTTTGAACCGGAGTTCTTGGCCTCCTGCCGCTCCCTTAAAGAGGATGAGG
ACATTCACCAAGGTATATAAGCGAGGAGCTGTAGGCCGGTCCATTGACATGAGTCAGTTC
TCTGGATATGATGAATTAAAGCATGCTCTGGCACGGATGTTCAGTATAGAGGGGCAACTT
GAGGAACGGCAGAGAATTGGTTGGAAGCTCGTTTACAAGGATCATGAAGATGACATCCTA
CTTCTTGGCGACGACCCATGGGAGGAATTTGTCGGTTGCGTGAAATGCATTAGGATCCTT
TCACCTCAAGAAGTTCAGCAGATGAGCTTGGAGGGTTGTGATCTCGGGAACAACATTCCC
CCGAATCAGGCCTGCAGCAGCTCAGACGGAGGGAATGCATGGAGGGCTCGCTGCGATCAG
AACTCCGGTAACCCTTCCAATGGTTCATATGAACAATTCGAATGACCAAATTCACCAGTC
CATATTGTCATGCTGCGCCGGTGTAAGTAGACAATCACCGGAGTGTTGTTGTAGATGTTA
TCAGCTTACATCCGGGAGCGCAAATGGCTCGGCGGATCAGTAGTGTTTTTTTTGTCTATA
TGTGTAGTTTCTCACACATCAAAAGGGAGTAGGGATGGTAAATGAAACTTACCTAGAGTT
TCTTAAGGTTAGGCGAAAGATGATTGTACTGTTGGAAAGGCAGTTCTGTAGTAAAATGAT
TCTTCT

CDS

2976 bp

>Os06t0702600-01 Auxin response factor 19, Control of leaf angle
ATGATGAAGCAGGCGCAGCAGCAGCCGCCGCCGCCACCGGCGAGCTCTGCGGCGACGACG
ACCACCGCGATGGCAGCCGCTGCGGCGGCGGCGGTGGTGGGGAGCGGGTGCGAAGGGGAG
AAGACGAAGGCGCCGGCGATCAACTCGGAGCTGTGGCACGCCTGCGCGGGGCCGCTGGTG
TCGCTGCCGCCGGCGGGCAGCCTCGTCGTCTACTTCCCCCAGGGCCACAGCGAGCAGGTT
GCAGCCTCTATGCAAAAGGATGTTGATGCACATGTTCCAAGCTACCCAAATCTGCCTTCA
AAGTTGATTTGCCTTCTGCATAACGTCACTTTACATGCGGACCCAGAAACAGATGAAGTG
TATGCACAAATGACTCTTCAGCCAGTTACTTCATATGGGAAGGAGGCCCTGCAGTTATCA
GAGCTTGCACTCAAACAAGCGAGACCACAGACAGAATTCTTTTGCAAGACACTGACTGCA
AGTGATACAAGTACTCATGGAGGCTTCTCTGTGCCTCGTCGAGCTGCAGAAAAGATATTT
CCTCCACTGGACTTCTCAATGCAACCACCTGCACAAGAACTACAGGCCAGGGATTTGCAT
GATAATGTGTGGACATTCCGTCACATATATCGGGGTCAGCCAAAAAGGCATCTGCTTACC
ACTGGCTGGAGTCTATTTGTAAGCGGCAAGAGGTTATTTGCTGGAGATTCTGTCATTTTT
GTCAGGGATGAAAAGCAGCAACTTCTATTAGGAATCAGGCGTGCTAACCGACAGCCAACT
AACATATCATCATCTGTCCTTTCAAGTGACAGCATGCACATAGGGATTCTTGCTGCTGCA
GCCCATGCTGCTGCCAACAATAGCCCATTTACCATCTTTTATAACCCTAGGGCCAGTCCT
ACTGAATTTGTTATCCCATTTGCTAAGTATCAGAAGGCAGTCTATGGTAATCAAATATCT
TTAGGGATGCGCTTTCGCATGATGTTTGAGACTGAGGAATTAGGAACACGAAGATACATG
GGAACAATAACTGGCATAAGTGATCTAGATCCAGTAAGATGGAAAAACTCGCAGTGGCGC
AACTTACAGGTTGGTTGGGATGAATCCGCAGCCGGTGAAAGGCGAAATAGGGTTTCTATC
TGGGAGATTGAACCGGTCGCTGCTCCATTTTTCATATGTCCTCCACCATTTTTTGGTGCG
AAGCGGCCCAGGCAATTAGATGACGAGTCCTCGGAAATGGAGAATCTCTTAAAGAGGGCT
ATGCCTTGGCTTGGTGAGGAAATATGCATAAAGGATCCTCAGACTCAGAACACCATAATG
CCTGGGCTGAGCTTGGTTCAGTGGATGAACATGAACATGCAACAGAGCTCCTCATTTGCG
AATACAGCCATGCAGTCTGAGTACCTTCGATCATTGAGCAACCCCAACATGCAAAATCTT
GGTGCCGCCGATCTCTCTAGGCAATTATGCCTGCAGAACCAGCTTCTTCAACAGAACAAT
ATACAGTTTAATACTCCCAAACTTTCTCAGCAAATGCAGCCAGTCAATGAGTTAGCAAAG
GCAGGCATTCCGTTGAATCAGCTTGGTGTGAGCACCAAACCTCAGGAACAGATTCATGAT
GCTAGCAACCTTCAGAGGCAACAACCTTCCATGAACCATATGCTTCCTTTGAGCCAAGCT
CAAACCAATCTTGGCCAAGCTCAGGTCCTTGTCCAAAATCAAATGCAACAGCAACATGCA
TCTTCAACTCAAGGTCAACAACCAGCTACCAGCCAGCCCTTGCTTCTGCCCCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAACAACAACAACAACAGCAACAACAACAAAAATTGCTA
CAACAGCAGCAGCAACAGCTTTTGCTCCAGCAACAGCAGCAATTGAGTAAGATGCCTGCA
CAGTTGTCAAGTCTGGCGAATCAGCAGTTTCAGCTAACTGATCAACAGCTTCAGCTGCAA
CTGTTACAAAAACTACAGCAACAACAGCAGTCATTGCTTTCACAACCTGCAGTCACCCTT
GCACAATTACCTCTGATCCAAGAACAGCAGAAGTTACTTCTGGATATGCAACAGCAGCTG
TCAAACTCCCAAACACTTTCCCAACAACAAATGATGCCTCAACAAAGTACCAAGGTTCCA
TCACAGAATGATGGACTTCTACATCAAAATTTCCCTATGTCCAACTTCAACCAGCCACAG
ATGTTCAAAGATGCTCCTCCTGATGCTGAAATTCATGCTGCTAATACAAGTAACAATGCA
TTGTTTGGAATCAATGGTGATGGTCCGCTGGGCTTCCCTATAGGACTAGGAACAGATGAT
TTCCTGTCGAATGGAATTGATGCTGCCAAGTACGAGAACCATATCTCAACAGAAATTGAT
AATAGCTACAGAATTCCGAAGGATGCCCAGCAAGAAATATCATCCTCAATGGTTTCACAG
TCATTTGGTGCATCAGATATGGCATTTAATTCAATTGATTCCACGATCAACGATGGTGGC
TTTTTGAACCGGAGTTCTTGGCCTCCTGCCGCTCCCTTAAAGAGGATGAGGACATTCACC
AAGGTATATAAGCGAGGAGCTGTAGGCCGGTCCATTGACATGAGTCAGTTCTCTGGATAT
GATGAATTAAAGCATGCTCTGGCACGGATGTTCAGTATAGAGGGGCAACTTGAGGAACGG
CAGAGAATTGGTTGGAAGCTCGTTTACAAGGATCATGAAGATGACATCCTACTTCTTGGC
GACGACCCATGGGAGGAATTTGTCGGTTGCGTGAAATGCATTAGGATCCTTTCACCTCAA
GAAGTTCAGCAGATGAGCTTGGAGGGTTGTGATCTCGGGAACAACATTCCCCCGAATCAG
GCCTGCAGCAGCTCAGACGGAGGGAATGCATGGAGGGCTCGCTGCGATCAGAACTCCGGT
AACCCTTCCAATGGTTCATATGAACAATTCGAATGA

Protein

991 aa

>Os06t0702600-01 Auxin response factor 19, Control of leaf angle
MMKQAQQQPPPPPASSAATTTTAMAAAAAAAVVGSGCEGEKTKAPAINSELWHACAGPLV
SLPPAGSLVVYFPQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHNVTLHADPETDEV
YAQMTLQPVTSYGKEALQLSELALKQARPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIF
PPLDFSMQPPAQELQARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIF
VRDEKQQLLLGIRRANRQPTNISSSVLSSDSMHIGILAAAAHAAANNSPFTIFYNPRASP
TEFVIPFAKYQKAVYGNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWR
NLQVGWDESAAGERRNRVSIWEIEPVAAPFFICPPPFFGAKRPRQLDDESSEMENLLKRA
MPWLGEEICIKDPQTQNTIMPGLSLVQWMNMNMQQSSSFANTAMQSEYLRSLSNPNMQNL
GAADLSRQLCLQNQLLQQNNIQFNTPKLSQQMQPVNELAKAGIPLNQLGVSTKPQEQIHD
ASNLQRQQPSMNHMLPLSQAQTNLGQAQVLVQNQMQQQHASSTQGQQPATSQPLLLPQQQ
QQQQQQQQQQQQQQQQQKLLQQQQQQLLLQQQQQLSKMPAQLSSLANQQFQLTDQQLQLQ
LLQKLQQQQQSLLSQPAVTLAQLPLIQEQQKLLLDMQQQLSNSQTLSQQQMMPQQSTKVP
SQNDGLLHQNFPMSNFNQPQMFKDAPPDAEIHAANTSNNALFGINGDGPLGFPIGLGTDD
FLSNGIDAAKYENHISTEIDNSYRIPKDAQQEISSSMVSQSFGASDMAFNSIDSTINDGG
FLNRSSWPPAAPLKRMRTFTKVYKRGAVGRSIDMSQFSGYDELKHALARMFSIEGQLEER
QRIGWKLVYKDHEDDILLLGDDPWEEFVGCVKCIRILSPQEVQQMSLEGCDLGNNIPPNQ
ACSSSDGGNAWRARCDQNSGNPSNGSYEQFE*

5'UTR

chr06:29657101..29657409 (+ strand) : 309 bp

CDS

chr06:29657410..29657524 (+ strand) : 115 bp

chr06:29658030..29658151 (+ strand) : 122 bp

chr06:29659534..29659632 (+ strand) : 99 bp

chr06:29659719..29659775 (+ strand) : 57 bp

chr06:29659884..29660039 (+ strand) : 156 bp

chr06:29660121..29660205 (+ strand) : 85 bp

chr06:29660476..29660566 (+ strand) : 91 bp

chr06:29660708..29660872 (+ strand) : 165 bp

chr06:29660965..29661087 (+ strand) : 123 bp

chr06:29661235..29661310 (+ strand) : 76 bp

chr06:29661414..29661543 (+ strand) : 130 bp

chr06:29661852..29662795 (+ strand) : 944 bp

chr06:29663306..29663725 (+ strand) : 420 bp

chr06:29664240..29664430 (+ strand) : 191 bp

chr06:29664598..29664799 (+ strand) : 202 bp

3'UTR

chr06:29664800..29665060 (+ strand) : 261 bp

FASTA

>Os06t0702600-01 class=Sequence position=chr06:29657101..29665060 (+ strand)
CAGCATCACC ACCACCCTAC TCTCTCTCTC TAGCTAGGGT TGCGCTGCTT CGGTCTCGGT CTTGGCGCCG CCTGCCTCGC
CCTTCTTGCT CGCCCCTGCT CCCCTGTCCC TCTCGTGTCG GGGCGACGGA CGGACATCCT CACCCGCGCG CACGTACGGG
TGATCGATCG ATTGATTCCT GCTCCGACGA AGACGGCGGC GGCGCCGGTG ACCTCGCCGG ACATGCGCGG GGCCCGCTGA
GGTCTTTGTT GCCGGCGAAA GGGGTGGAGT GATTGACTCG GTCGGTGTCT GCCTGTCTGG TCTGAGGTCA TGATGAAGCA
GGCGCAGCAG CAGCCGCCGC CGCCACCGGC GAGCTCTGCG GCGACGACGA CCACCGCGAT GGCAGCCGCT GCGGCGGCGG
CGGTGGTGGG GAGCGGGTGC GAAGGTAGGA CGAGTTCTTG CTTTGCTTGC TGCTTCCAAT GGCGGTTCGG GATGGAGCAG
TGGTTGCCTT GCCGTGTTCT TGTTTCTGCA ATCTGGTCCC TGTTTTATCG CGTTATTATT TCGCCACAAA ATTAGGCAAA
TAAATCCTTT CTTATTCTTC TTGGATTTTG GATTACTGCA TTTTTTTTTC TCTGCATTTT TGTTCCTGTG ATTTCTGGCG
AGCGTCGCAG CATTTACTGT TCCACATTTA TGCCCCCTCA AAGTTTGAGT AATCGCAACA TAGGAGTACG AGTAGCTGCT
ACTGCAGTGC TAAGCCATGT GCAGAGATTA ATTGGTTTGT GTAAAAACCT GGTCGTTTAG GGGGCGAACT GCAAATTACA
CACAAGCTCG CCGGCGGCGT AGGGCAAAAT GCATTTGGTC ATTTGGATCA TCCAGCTTAC GGCGAGATTA TTAGGGAAAA
AAGTTTTCAC TGTTTTGTTT GGTTACTGAT TGGCCGTGGT GTTTTGCAGG GGAGAAGACG AAGGCGCCGG CGATCAACTC
GGAGCTGTGG CACGCCTGCG CGGGGCCGCT GGTGTCGCTG CCGCCGGCGG GCAGCCTCGT CGTCTACTTC CCCCAGGGCC
ACAGCGAGCA GGTGACTTCG AAGTTCTATT GATTTTTTTT TCTTCTTTGT TTCATTTTCA TAGCCATGGA TGGCCTCGTT
TTGAGACCCT TTTTAATTGA CTTTTTGTTC TTATGATTCT AGTTTTTTTT TGGTTTGCTT TTTTTAAAAA TAAGAATTCT
AATTCGTCTC GTTCTGAATG TTGATGATTC TTGCACGAAT AAGTTCACAA CTTGCTGTCC TTTTATGAGT TCTTGAGAGG
TGGAATGCTT TTTTTTTTGT TTGGTGTTCC ATTTTGTTCA GTAGTGGTGG CAGTTATAAT TATATGATGG GAATAATGGG
ATGTGTTTCT AGGGCCAAAA TGATATATTT TGTTCACATC TTTATTTCTG GGAATGTTTC ACTTATCGCC TAGGAGTATA
TGTCTCCTGG AATCTTTTCT GAATTCATGT ATCTTCTGTT GCCGAAAAGT AGTAGTATTA TCTTTTCATG AATTGTTTTT
TTTGGTTCTT TGATATTACA GCCATCATTG ATCTATTTGG TAATTTGATT TTCTATGTTT TATACGATGT GGGAGATCTC
GATTGGTCTG TTTGTTCATT GTACTTTATT TTGTTTCATT AGCTACCAAT TTTTAGCTTA TGGCCAAAGT GGTTGGAAGT
ATTGGGCATA CTGGACCCCC TTCTTTTATG GGTTTATGGT GTGTGGCACC ATTCTCTTGC TCTGTCGTTT GGTAGATGAA
GCAGCCAAGC AGCTTCGATT TTTTTTTCGC ATTTAATGGT AATTACATTC AGTAGCTTCT TTTGCAACTT TCTTGGCTTT
GGTGTTGGGG CTACCTTATT TTGAGCAAGT TTGAAGTATG GGGTGATGAA CTGTTTGGAT TTGGAAAAGA TTCTTTATCT
AAAAGCTAGT GCTGGAAGGT GCCTAATTCT GTATTGGTTT TTCCTATCCC TTTTGTGATG ATGAGAAAAA GGGAACTTTT
TTAGTAACCG TGTGATGGCT ATGTCCTCAT AGCACATGCC GATGTGAGGC AAGAGAAAGT TTTGCTGTGG CTTAATTAAT
ATAAAACGAA TTTATGCTTT AAACTTAAAT TCAGCCTAAT GTTGGTCATG CTTTTTTGTG TGGGGAAATT GCTGTGGTTG
AAGTAGGGAA CATTTTGTAA AAGGGAGAAG AGTTACATAG AGAATTTAAA ATAAAACTTA AGCAACATAA AAATAATATT
TGTAAAAATT CGGTTGCCAT TTTTTCCTGT GATTTTCATC GTGATCGAGT ACCCTTTGGC CTTTGTTTCC CTGTGACTGA
TGATTTTTTG TTGATAAGGT CCCAGTATCA ACAGATTTAT ATCTGCATCC TTCTGATTCC AGTGTGAAAA TTGTTGCTTA
GAGCCACAGA TTTAAGTATC TTTCATATTG CAGGTTGCAG CCTCTATGCA AAAGGATGTT GATGCACATG TTCCAAGCTA
CCCAAATCTG CCTTCAAAGT TGATTTGCCT TCTGCATAAC GTCACTTTAC ATGTAATCTA CAGACGTGAG ATGTTATTAT
AGTTTCTTTT TACCTTTAAC CATCTATGCT GAAAGTATGG TCCATCTATA TTTCTTAGGC GGACCCAGAA ACAGATGAAG
TGTATGCACA AATGACTCTT CAGCCAGTTA CTTCAGTAAG CATCTGATGC CCTTGCAGAT CCCCAACAAA TTTTCATCGA
TTTCCCTTTT GTTCATGGAT TGTAACCCAC CTTTTGTGTT TCAATTGATT GTGTATTGAA AAGTATGGGA AGGAGGCCCT
GCAGTTATCA GAGCTTGCAC TCAAACAAGC GAGACCACAG ACAGAATTCT TTTGCAAGAC ACTGACTGCA AGTGATACAA
GTACTCATGG AGGCTTCTCT GTGCCTCGTC GAGCTGCAGA AAAGATATTT CCTCCACTGG TATGCAAAGA TCAGAGTCAT
ATGCCATTGT TTACTTCATT TTCTGCATCT TTATTATTAA ATCACTGGTG CTTGCTGTAG GACTTCTCAA TGCAACCACC
TGCACAAGAA CTACAGGCCA GGGATTTGCA TGATAATGTG TGGACATTCC GTCACATATA TCGGGGTAAG CAAACAATAG
CAACGATAAa aataaagaaa atatatagta taacaaatga aaaattctgc tgttgacatc ctactttata gttgttgata
cttAATATTT GGCATGATTG GCTGAAATTG TGTGCATATG CATGTTTTGT TCTTTACGCA TGGCAGTTCC TGTATTCAAA
CTTCAAATTA TTGTGTTTTT ATGTAATATA TGTGGCTCGA TATGTATTTT GTCCAGACAA AATATTTAAT CGCCCATGTG
TTTTGATATA AACAGGTCAG CCAAAAAGGC ATCTGCTTAC CACTGGCTGG AGTCTATTTG TAAGCGGCAA GAGGTTATTT
GCTGGAGATT CTGTCATTTT TGTCAGGTAT GCTACAGCTT ATATGCTATA TCTTTAAAGT TTGAACTAAA TGATGAGAAC
AAGAGATGCA TGATGTTTTC TTGTTTTTTG TGGTTATTCA CATCGATTTA ACGGTGGTCT TCTTTCTTTT TCCTTTTTAT
TTTTTAGGGA TGAAAAGCAG CAACTTCTAT TAGGAATCAG GCGTGCTAAC CGACAGCCAA CTAACATATC ATCATCTGTC
CTTTCAAGTG ACAGCATGCA CATAGGGATT CTTGCTGCTG CAGCCCATGC TGCTGCCAAC AATAGCCCAT TTACCATCTT
TTATAACCCT AGGTCAGTTC TGTACTAAAG TATGTTTTGA TAATTCTCTA GTAGTAACTA CTGGAGAGCT GTTGAAATGA
TGGTATGCAA ATTCCGTATT TCAGGGCCAG TCCTACTGAA TTTGTTATCC CATTTGCTAA GTATCAGAAG GCAGTCTATG
GTAATCAAAT ATCTTTAGGG ATGCGCTTTC GCATGATGTT TGAGACTGAG GAATTAGGAA CACGAAGGTA CTTTTTTCTC
ACTTTTCCAT AAATGGAAAT AATTGTGGAC TGAATTGCCA TATTATATGA TTATACATGT CAATGACAAA GCTGGGAATG
ATTCTTAATT TTCTTTTTAA ATTTTTTGTT GTTGTTTTCT TGCCCTTATT GCAGATACAT GGGAACAATA ACTGGCATAA
GTGATCTAGA TCCAGTAAGA TGGAAAAACT CGCAGTGGCG CAACTTACAG GTTTGTTCTC TGGTTAATTT TGGCAGCACT
ATAACCTAGT ATTTCTTGTG CCCATTTTCT GCTGCTGATA CAATATATTT TGTGTTTTTT CATTCTTGAA CAGGTTGGTT
GGGATGAATC CGCAGCCGGT GAAAGGCGAA ATAGGGTTTC TATCTGGGAG ATTGAACCGG TCGCTGCTCC ATTTTTCATA
TGTCCTCCAC CATTTTTTGG TGCGAAGCGG CCCAGGCAAT TAGGTGAGCT CTCATGTTAC ATTGCCATTA CTTCTTTTAT
ATTCTTTAAC TGCTCTTGAA TCCAGTTATT GATCCAGGAG AATACCCCTT AGTCATTTGT TATGTCTAGC TACTAGCTTG
GAAAATATAC CTGCAACCAA GCTTTACCTT TGAGATGACA ATCTGGATAA CATACCTTTT GAGTTGTACG CACCCAACTG
ATTTGAGCTA ATTATCGAAT TCTAGTGGTG TTGTGAATTC AAATAGATGA ATTGTTTCAC TAAACTGCTT GTATGTATGC
TTAACTTTTG ATCCCTACCA TGTAATTACA GATGACGAGT CCTCGGAAAT GGAGAATCTC TTAAAGAGGG CTATGCCTTG
GCTTGGTGAG GAAATATGCA TAAAGGATCC TCAGACTCAG AACACCATAA TGCCTGGGCT GAGCTTGGTT CAGTGGATGA
ACATGAACAT GCAACAGAGC TCCTCATTTG CGAATACAGC CATGCAGTCT GAGTACCTTC GATCATTGAG CAACCCCAAC
ATGCAAAATC TTGGTGCCGC CGATCTCTCT AGGCAATTAT GCCTGCAGAA CCAGCTTCTT CAACAGAACA ATATACAGTT
TAATACTCCC AAACTTTCTC AGCAAATGCA GCCAGTCAAT GAGTTAGCAA AGGCAGGCAT TCCGTTGAAT CAGCTTGGTG
TGAGCACCAA ACCTCAGGAA CAGATTCATG ATGCTAGCAA CCTTCAGAGG CAACAACCTT CCATGAACCA TATGCTTCCT
TTGAGCCAAG CTCAAACCAA TCTTGGCCAA GCTCAGGTCC TTGTCCAAAA TCAAATGCAA CAGCAACATG CATCTTCAAC
TCAAGGTCAA CAACCAGCTA CCAGCCAGCC CTTGCTTCTG CCCCAGCAGC AGCAACAGCA GCAGCAGCAG CAGCAACAAC
AACAACAACA GCAACAACAA CAAAAATTGC TACAACAGCA GCAGCAACAG CTTTTGCTCC AGCAACAGCA GCAATTGAGT
AAGATGCCTG CACAGTTGTC AAGTCTGGCG AATCAGCAGT TTCAGCTAAC TGATCAACAG CTTCAGCTGC AACTGTTACA
AAAACTACAG CAACAACAGC AGTCATTGCT TTCACAACCT GCAGTCACCC TTGCACAATT ACCTCTGATC CAAGAACAGC
AGAAGTTACT TCTGGATATG CAACAGCAGC TGTCAAACTC CCAAACACTT TCCCAACAAC AAATGATGCC TCAACAAAGT
ACCAAGGTTC CATCACAGAA CACACCATTG CCACTGCCTG TGCAACAAGA GCCACAACAG AAGCTTCTAC AGAAGCAAGC
GATGCTAGCA GACACTTCAG AAGCTGCCGT TCCGCCGACC ACATCAGTCA ATGTCATTTC AACAACTGGA AGCCCTTTGA
TGACAACTGG TGCTACTCAT TCTGTACTTA CAGAAGAAAT CCCTTCTTGT TCAACATCAC CATCCACAGC TAATGGCAAT
CACCTTCTAC AACCAATACT TGGTAGGAAC AAACATTGTA GCATGATCAA CACAGAAAAG GTTCCTCAGT CTGCTGCTCC
TATGTCAGTT CCAAGCTCCC TTGAAGCTGT CACAGCAACC CCGAGAATGA TGAAGGATTC ACCAAAGTTG AACCATAATG
TTAAACAAAG TGTAGTGGCT TCAAAATTAG CAAATGCTGG GACTGGTTCT CAAAATTATG TGAACAATCC ACCTCCAACG
GACTATCTGG AAACTGCTTC TTCCGCAACT TCAGTGTGGC TTTCCCAGAA TGATGGACTT CTACATCAAA ATTTCCCTAT
GTCCAACTTC AACCAGCCAC AGATGTTCAA AGATGCTCCT CCTGATGCTG AAATTCATGC TGCTAATACA AGTAACAATG
CATTGTTTGG AATCAATGGT GATGGTCCGC TGGGCTTCCC TATAGGACTA GGAACAGATG ATTTCCTGTC GAATGGAATT
GATGCTGCCA AGTACGAGAA CCATATCTCA ACAGAAATTG ATAATAGCTA CAGAATTCCG AAGGATGCCC AGCAAGAAAT
ATCATCCTCA ATGGTTTCAC AGTCATTTGG TGCATCAGAT ATGGCATTTA ATTCAATTGA TTCCACGATC AACGATGGTG
GCTTTTTGAA CCGGAGTTCT TGGCCTCCTG CCGCTCCCTT AAAGAGGATG AGGACATTCA CCAAGGTCAG TACCTTTCTG
TTTCTTTATC TGAAGCCAAC CAACAGCTTC TTCTGTGGTC AGCGTGAATT TTAATTATAA GTAAACATGA AGCTTTTTAT
CTTTTTCATT ACCATGGTAA CAATAATTTA AACTTGCGAT GGTAGTTTCA TCTACTGGAA ACTAAGTTCT CATTTATTAA
CCTTCAAAAC ATTGAAGTAA ATGTGCATAT GGATAAGCCG AATTGCATGA TAAGTCTGAG TCAGATTCTG TTCCGTGATG
TGATGAGGAC AGTATGAGTA GTTTTTTTTT TTGGTTGCCT AGGAGATGTT AAGAAGTTTT ATGGTTGAGT TTCTAGCCGA
ACATAACTTT TATGTGCGAA TCTCACATGT TTGTATTAAT TATACTCTTT AAGATAAGAG TTTTCTAAGT GTAACTTCAG
GATAAATCTG TTAAACGAAG CACCGTTTCT TTGTTGTATT ATAGCATTTT ATGGATGCAT TTGCAGTTGC ATCTTTGCAT
AACCTATATG GTACTGTAGG TATATAAGCG AGGAGCTGTA GGCCGGTCCA TTGACATGAG TCAGTTCTCT GGATATGATG
AATTAAAGCA TGCTCTGGCA CGGATGTTCA GTATAGAGGG GCAACTTGAG GAACGGCAGA GAATTGGTTG GAAGCTCGTT
TACAAGGATC ATGAAGATGA CATCCTACTT CTTGGCGACG ACCCATGGGA GTAAGTTCAG CTCTCATTTT CTTCTCATGC
TTGCATAAAA CACTCTCAAG TTTCGCTTCC AGAATCTGAA TGGATAGATG GCCGCATTCC ACCCACAATC AACATCGCCT
ATGTATCGGG CATTCATGTT CTTGCATTCC TAATGAGTGC TACTGTGGAT CATACAGGGA ATTTGTCGGT TGCGTGAAAT
GCATTAGGAT CCTTTCACCT CAAGAAGTTC AGCAGATGAG CTTGGAGGGT TGTGATCTCG GGAACAACAT TCCCCCGAAT
CAGGCCTGCA GCAGCTCAGA CGGAGGGAAT GCATGGAGGG CTCGCTGCGA TCAGAACTCC GGTAACCCTT CCAATGGTTC
ATATGAACAA TTCGAATGAC CAAATTCACC AGTCCATATT GTCATGCTGC GCCGGTGTAA GTAGACAATC ACCGGAGTGT
TGTTGTAGAT GTTATCAGCT TACATCCGGG AGCGCAAATG GCTCGGCGGA TCAGTAGTGT TTTTTTTGTC TATATGTGTA
GTTTCTCACA CATCAAAAGG GAGTAGGGAT GGTAAATGAA ACTTACCTAG AGTTTCTTAA GGTTAGGCGA AAGATGATTG
TACTGTTGGA AAGGCAGTTC TGTAGTAAAA TGATTCTTCT 

Locus: Os06g0702600

Loading...

Locus: Os06g0702600

Loading...