Os06t0703500-01

Locus

Os06g0703500

Description

Similar to SBP-domain protein 5 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SPL12

CGSNL Gene Name

RICE SQUAMOSA PROMOTER-BINDING-LIKE 12

Oryzabase Gene Symbol Synonym(s)

OsSPL12, DLN176, OsDLN176

Oryzabase Gene Name Synonym(s)

Squamosa promoter-binding-like protein 12, SQUAMOSA Promoter-Binding Protein-Like 12a, DLN repressor 176, DLN motif protein 176

Transcript Evidence

AK102136 (DDBJ, Best hit)

Protein Evidence

Q5Z818 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcription factor, SBP-box (IPR004333)

Full-length cDNA

J033085H14 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0703500-01)

RiceXPro (AK102136)

Others

Oryzabase (6895)

KEGG (Os06t0703500-01)

Transcript

2242 bp

>Os06t0703500-01 Similar to SBP-domain protein 5 (Fragment).
CCAATGATCAAATCAAGCAAAGCACCACTGCTGCTGCAAAGAACACCAGATAGATCAAAC
TCTCTCTCTCTCTGGTGTTGCTGTTAGTTGGTAGTTTGGTACTACTTGGTACTCTGGGAA
GAAGAAAGAGATTATTATAGCAGAAAAGCAGCACCATGGCATAGCTCCAGGCAGCAAAAC
CAGAATACAACGGGGATAACGATTCTCTCTCAGCTAAAGGAGGTCGGGGAAACAAGTGGG
ATAGGATCTCTCTCAAGTCGAGGTGAGTGAGAACTCAGCCAAGAACAACAATGGAGTCTC
TGTTGCTTTAGTTCTGCCAGCCAATTGGTTTCAACTTTCAACGCTGCTACTTGTTATTCA
TCACCTCCTCGGATCGGTTTGATTTATGCTCAAGGTTGTGCTATGCATGGTCATGCTGAT
TGAGGGCAAGATTTGCAGGGAGAGGAAGGATCCACTGTGTTTCTTTTCTGGGAGAAAGGA
AAGTTGAGATTTGCAATATATACAAGTGTGAGCAGCAGCAGTTGAGATCCTTAATTCAGC
CATGGCTTCTTTTGGGATGAACTGGAATCAGAAGAGCCCTGTGTTTTGGGACTGGGAAAA
TCCAGCGCCTTTCGGTCCGAATACAATGGAAAATCCCAAGAGCATACCTCACCCTGAACC
AAGAGGTGTAGTTGTCGCGGCCGCAAATCATGGATCCACCAATTCATCCGGTGGCACGTT
CACTTCTAGCTCGGAGCTAGCCAATGGTTCATCGAAGAGCTCCTTGTCAGCGTCGTTCGA
TTCCTCATCCAAGCTGGGGAACAGCTTAGAGTTCAGGTTTGCTTCTGTCAAAGGGCATGG
CAAGAACATGTGCAAGGATGGCGAGGCCGGTAGAGTTGAAGACTCGGGCACTTCTCCAGC
TGTGGCAGTTAGCCATGGTGAGCCGGTAATAGGACTCAAGTTAGGGAAGAGAACTTACTT
TGAAAATGTTTGTGGAGGGCAGAATGTCAAGAGCTCCTCTGCAGCTTCAGGTGTGACTTG
TCCATCTACTGTGGTCAAGAAGATGAAGGTGTCTCAGCAGAGCACACAAAGCTCATACTG
CCAAGTTGAAGGCTGCAAAGTCGATCTGTCCTCCGCAAGAGAATACCATCGCAAGCACAA
AGTTTGTGAAGCTCATTCTAAGGCACCAAAGGTTATTGTTTCTGGTCTGGAGCGCCGTTT
TTGCCAACAGTGTAGTCGGTTTCATGGTTTAGCTGAATTTGACCAGAAAAAGAAAAGTTG
CCGCAGGCGTCTATCTGATCATAATGCACGAAGAAGGAAACCGCAACAAGAGGCAATTTC
ATTTGGTTCATCAAGGCTCGCCACGATGTTTTACGATGCAAGGCAGCAGACAGATATTTA
CTTTGGCCAATCTCCTTTTGGCCAAGTGAGAAGCAATGCAATTTCTTCATGTGACAACCT
GGGAGGCTTCAAATTTACAGAAGCAAAACTCCCCTGGATGAAGCCAATGAAAACTATAGG
CCTTGAGGATCTGAATTTCTCTACCCTGCAGATGCCAGGCAATGTTGTGTCGCATACGGT
GCATCATCATGATTTTGATGGGCTCATACCATTCAAGGGAAACACCCCGAAGGTCCTCAA
CCAAGGTGTGGATCCAGCCTGTGCCGTCGTGTCCTCCAACTCGAATGGAGCCCCGGATCT
TCGGCGTGCTCTCTCTCTTCTGTCAAGCGATTCCTGGGGCCCGGCCGACGTTCAGGCCGG
CTCCCAGGTGCATCCCGGTGGAGTGATGCCGCCCCTCGCCGTTGCCGCCGCCACCGTCAC
CGCCCCGACGAACCCTGTCAGTGTGATGCATGCTCTGCACCCGTCCACCGGAGGAGGAGG
ATTCTGGCAAGACGGCGACGACCCGCCTCCGCTCGATCATGCCTCGCAGGCTCAGGCGTT
CATGCATCCTGGCAATGGCAGCAGCTCCGGCTATGGCCATCTGCACTGATTCTGCTGCAT
CTATTTGGAACGGGTTGATGACTGGTTACTCCGTTCATGATCTTACCCTGTCAGTGATGG
ACTCTGAATAATTTGGGGGCGAATTGTCCTGCAACCCCAGGATTTATTATTTCTATTTTT
GAAACCAAACCACCAGGATATTTGCCATTGGATGAGAAGTGTTCATGATCATGAAATGAT
CTGTTTTGTTCCACAGAATCTGACATATCTACTACTCGTCTTGGGAATGAGCTGAGATCG
ATTCGTGTGTTGTTCATTCAGG

CDS

1428 bp

>Os06t0703500-01 Similar to SBP-domain protein 5 (Fragment).
ATGGCTTCTTTTGGGATGAACTGGAATCAGAAGAGCCCTGTGTTTTGGGACTGGGAAAAT
CCAGCGCCTTTCGGTCCGAATACAATGGAAAATCCCAAGAGCATACCTCACCCTGAACCA
AGAGGTGTAGTTGTCGCGGCCGCAAATCATGGATCCACCAATTCATCCGGTGGCACGTTC
ACTTCTAGCTCGGAGCTAGCCAATGGTTCATCGAAGAGCTCCTTGTCAGCGTCGTTCGAT
TCCTCATCCAAGCTGGGGAACAGCTTAGAGTTCAGGTTTGCTTCTGTCAAAGGGCATGGC
AAGAACATGTGCAAGGATGGCGAGGCCGGTAGAGTTGAAGACTCGGGCACTTCTCCAGCT
GTGGCAGTTAGCCATGGTGAGCCGGTAATAGGACTCAAGTTAGGGAAGAGAACTTACTTT
GAAAATGTTTGTGGAGGGCAGAATGTCAAGAGCTCCTCTGCAGCTTCAGGTGTGACTTGT
CCATCTACTGTGGTCAAGAAGATGAAGGTGTCTCAGCAGAGCACACAAAGCTCATACTGC
CAAGTTGAAGGCTGCAAAGTCGATCTGTCCTCCGCAAGAGAATACCATCGCAAGCACAAA
GTTTGTGAAGCTCATTCTAAGGCACCAAAGGTTATTGTTTCTGGTCTGGAGCGCCGTTTT
TGCCAACAGTGTAGTCGGTTTCATGGTTTAGCTGAATTTGACCAGAAAAAGAAAAGTTGC
CGCAGGCGTCTATCTGATCATAATGCACGAAGAAGGAAACCGCAACAAGAGGCAATTTCA
TTTGGTTCATCAAGGCTCGCCACGATGTTTTACGATGCAAGGCAGCAGACAGATATTTAC
TTTGGCCAATCTCCTTTTGGCCAAGTGAGAAGCAATGCAATTTCTTCATGTGACAACCTG
GGAGGCTTCAAATTTACAGAAGCAAAACTCCCCTGGATGAAGCCAATGAAAACTATAGGC
CTTGAGGATCTGAATTTCTCTACCCTGCAGATGCCAGGCAATGTTGTGTCGCATACGGTG
CATCATCATGATTTTGATGGGCTCATACCATTCAAGGGAAACACCCCGAAGGTCCTCAAC
CAAGGTGTGGATCCAGCCTGTGCCGTCGTGTCCTCCAACTCGAATGGAGCCCCGGATCTT
CGGCGTGCTCTCTCTCTTCTGTCAAGCGATTCCTGGGGCCCGGCCGACGTTCAGGCCGGC
TCCCAGGTGCATCCCGGTGGAGTGATGCCGCCCCTCGCCGTTGCCGCCGCCACCGTCACC
GCCCCGACGAACCCTGTCAGTGTGATGCATGCTCTGCACCCGTCCACCGGAGGAGGAGGA
TTCTGGCAAGACGGCGACGACCCGCCTCCGCTCGATCATGCCTCGCAGGCTCAGGCGTTC
ATGCATCCTGGCAATGGCAGCAGCTCCGGCTATGGCCATCTGCACTGA

Protein

475 aa

>Os06t0703500-01 Similar to SBP-domain protein 5 (Fragment).
MASFGMNWNQKSPVFWDWENPAPFGPNTMENPKSIPHPEPRGVVVAAANHGSTNSSGGTF
TSSSELANGSSKSSLSASFDSSSKLGNSLEFRFASVKGHGKNMCKDGEAGRVEDSGTSPA
VAVSHGEPVIGLKLGKRTYFENVCGGQNVKSSSAASGVTCPSTVVKKMKVSQQSTQSSYC
QVEGCKVDLSSAREYHRKHKVCEAHSKAPKVIVSGLERRFCQQCSRFHGLAEFDQKKKSC
RRRLSDHNARRRKPQQEAISFGSSRLATMFYDARQQTDIYFGQSPFGQVRSNAISSCDNL
GGFKFTEAKLPWMKPMKTIGLEDLNFSTLQMPGNVVSHTVHHHDFDGLIPFKGNTPKVLN
QGVDPACAVVSSNSNGAPDLRRALSLLSSDSWGPADVQAGSQVHPGGVMPPLAVAAATVT
APTNPVSVMHALHPSTGGGGFWQDGDDPPPLDHASQAQAFMHPGNGSSSGYGHLH*

5'UTR

chr06:29708505..29708687 (- strand) : 183 bp

chr06:29707865..29707903 (- strand) : 39 bp

chr06:29707329..29707594 (- strand) : 266 bp

chr06:29707061..29707113 (- strand) : 53 bp

CDS

chr06:29706384..29707060 (- strand) : 677 bp

chr06:29705999..29706135 (- strand) : 137 bp

chr06:29705354..29705623 (- strand) : 270 bp

chr06:29703831..29704174 (- strand) : 344 bp

3'UTR

chr06:29703558..29703830 (- strand) : 273 bp

FASTA

>Os06t0703500-01 class=Sequence position=chr06:29703558..29708687 (- strand)
CCAATGATCA AATCAAGCAA AGCACCACTG CTGCTGCAAA GAACACCAGA TAGATCAAAC TCTCTCTCTC TCTGGTGTTG
CTGTTAGTTG GTAGTTTGGT ACTACTTGGT ACTCTGGGAA GAAGAAAGAG ATTATTATAG CAGAAAAGCA GCACCATGGC
ATAGCTCCAG GCAGCAAAAC CAGGTCTGAA ATTATCCCTA TCTTTTCTTT GCAAGAACCA GAATCTTTTT ATGGCATGGC
ATTGTTTGTG GAGGAGTGAT TCTCCACATC ATTCAATCAT CTTTAGGCAG GGGGTGAGGG GTGGGCTACA ATGTGATTTC
CACCACAAAA AGGAGTTGTT CTTCTTTCTT AGGGTTGCTG CTGCTGCTGC TTTTGAGGAG TGGAGTAGTT GAGGCCATAG
TAGTAGTAGA AGTAGAAGTA AACTGGTATA GTCACTACTC ACTACACTAC CAGTTGGTGT TTGTTCTGAG CATTATTGGA
GTGTCAGGGA AGGGCATGTG CTTTTGTTGG TTGCTGTAGG AGGAGGCAGC CATCCACTGG GCCTCACTCT CCTCTTGTTG
CTGCCTCCTC CTCTTGTTAC TGTTCAGTCT CAGGCTCTCA GGCTCACAGG TGGGGTTTTG GGAGATACTA GTTAGGAGGG
AAAGGTTGCC ATCTTGTGTG TGTTGGATCT TTGTGAGTCA TGTCCTCTTT ATCTTGGTGC TTTTGCTTTT TCTTGTGTTT
TTTCTTTTCT TTCTCCTATC TTCTTTTGCC ACAAAACTTA TGGCTATTGT TTTCATCCAG GTAGAATACA ACGGGGATAA
CGATTCTCTC TCAGCTAAAG GAGGTGAGAT TCTTGGTTTC ACATCAAGTA TTATTGTTCT TTCTTTTACT TCCTTCAAAA
TAGTTTCTTT GCTTTTTATT TCATATATGG TTTGGTTTAT TTATGCTCCC CAACAAGCAA CTGGTTCATG TGCGGTAACA
AGGAGCAAAT AATGCAGCTC TGATTGACTT GGGGTAGTTG TTGTGGTGAT AGATTGGAAA GGGTTTAAAT AGCGGGTGGT
TGTGGTGATG AATGGGGGCC AGCCTTGATG GGGTTGATGC TGTCGTCTTT TAGGTCGGGG AAACAAGTGG GATAGGATCT
CTCTCAAGTC GAGGTGAGTG AGAACTCAGC CAAGAACAAC AATGGAGTCT CTGTTGCTTT AGTTCTGCCA GCCAATTGGT
TTCAACTTTC AACGCTGCTA CTTGTTATTC ATCACCTCCT CGGATCGGTT TGATTTATGC TCAAGGTTGT GCTATGCATG
GTCATGCTGA TTGAGGGCAA GATTTGCAGG GAGAGGAAGG ATCCACTGTG TTTCTTTTCT GGGAGAAAGG AAAGTTGAGG
TAATTGATCG TTTTCGCCTT TCTTCTCTTG CTATGATCCC CACAATAAAG CGCGTATAAT TCATTTTGGA TGGTATGTTG
TACTTGTCTT TTTATCTGAA AGACAAAATG ATTTTGGTAC CCGAGATATG TTTATTGCCT TTCTCATCCA AGTTCTGCAA
TTTGTTGTGA CGTGTGTTCT TTCTGTTCCT TCTTGTTTCT TGAAATCCTA TCAGATTTGC AATATATACA AGTGTGAGCA
GCAGCAGTTG AGATCCTTAA TTCAGCCATG GCTTCTTTTG GGATGAACTG GAATCAGAAG AGCCCTGTGT TTTGGGACTG
GGAAAATCCA GCGCCTTTCG GTCCGAATAC AATGGAAAAT CCCAAGAGCA TACCTCACCC TGAACCAAGA GGTGTAGTTG
TCGCGGCCGC AAATCATGGA TCCACCAATT CATCCGGTGG CACGTTCACT TCTAGCTCGG AGCTAGCCAA TGGTTCATCG
AAGAGCTCCT TGTCAGCGTC GTTCGATTCC TCATCCAAGC TGGGGAACAG CTTAGAGTTC AGGTTTGCTT CTGTCAAAGG
GCATGGCAAG AACATGTGCA AGGATGGCGA GGCCGGTAGA GTTGAAGACT CGGGCACTTC TCCAGCTGTG GCAGTTAGCC
ATGGTGAGCC GGTAATAGGA CTCAAGTTAG GGAAGAGAAC TTACTTTGAA AATGTTTGTG GAGGGCAGAA TGTCAAGAGC
TCCTCTGCAG CTTCAGGTGT GACTTGTCCA TCTACTGTGG TCAAGAAGAT GAAGGTGTCT CAGCAGAGCA CACAAAGCTC
ATACTGCCAA GTTGAAGGCT GCAAAGTCGA TCTGTCCTCC GCAAGAGAAT ACCATCGCAA GCACAAAGTT TGTGAAGCTC
ATTCTAAGGC ACCAAAGGTT ATTGTTTCTG GTCTGGAGCG CCGTTTTTGC CAACAGTGTA GTCGGTGAGA GCATAATCTT
ATTTCACTTT GCATGCTTTC AAGACTTCCT TTTTTATATG CACTACCCTC TTTAAATCAA TAGACACAAC AACAATGAAG
AAAATTGTCT CTATCTGTAT TGCATAAAGC ATATACCAGT ATAAATAAAG TCAAAGAAGT AGCACTAGTT TGCTTGGATT
AAAGTACAAC GCAAGGTTCG AGGTTATTGA TCTTTACTAG TTTGCTGTCT TATGTACTCT ATTGTTTTGT AGGTTTCATG
GTTTAGCTGA ATTTGACCAG AAAAAGAAAA GTTGCCGCAG GCGTCTATCT GATCATAATG CACGAAGAAG GAAACCGCAA
CAAGAGGCAA TTTCATTTGG TTCATCAAGG CTCGCCACGA TGTTTTACGG TAGTACTGAC CCCTTAGATG CATCACAATG
CTAGATGCCT TGTTCTGTTT TGATGACTGA AAGCTATTCC TTTAACCCAA TCAATACTGC TGAAATAGTA GGATGATACC
GTAAGCATTT TAACATGTAA CATATCCAGT TTTCTGCATA CGCACGACTG GTGGGTGTTA CCTGGTGGCA CACTTCTTTT
TAGAAGGGAG CTTAACCCAT CCTCTTGAGT CTTGACAGTT ACTATTATAT TGTTATATAA TAATGCATAG TAATCATATA
TGGTAGCTTG TGTATTTTCA TGATGTAGTT TTCCACTTGA CGCGTTTTTA CCAAGTCCTA CACAAATCTT TCATGGTGAC
AGTGTTTGCG ATTTTGCATT GCAGATGCAA GGCAGCAGAC AGATATTTAC TTTGGCCAAT CTCCTTTTGG CCAAGTGAGA
AGCAATGCAA TTTCTTCATG TGACAACCTG GGAGGCTTCA AATTTACAGA AGCAAAACTC CCCTGGATGA AGCCAATGAA
AACTATAGGC CTTGAGGATC TGAATTTCTC TACCCTGCAG ATGCCAGGCA ATGTTGTGTC GCATACGGTG CATCATCATG
ATTTTGATGG GCTCATACCA TTCAAGGGAA ACACCCCGAA GGTCCTCAAC CAAGGTACAT TAACATCTCT CAATTCATCA
CTGAACTTTA AAGAAAAGAC ATGCAGCTGT TGCAGCATCT TCAATTTTAA GTTTTTAACC ATGTGTTTTT ATTTAATGAT
CTAAATGGGA CTACCTATTT TAGCAATTCA ATTTCTTATC AGTAAATAGG TCCGACTGAT TTGACCTTTT GTTTGATTGT
TATCTGTACT GTTCACCTCT CTGCTATTCG ACAACGCCGA GACAGCATTT TATTCTCCAT AATTCCTTTT CATACGGCTA
CAATCTTCTG AAAAGTCTTT GTTGCTAAAC AGTCAGCATT CCTGACTTGG AGTTTGGATT AAACAAGCTA CTTAGTCATA
AGAACACATC ATTTTGCTCC CTTTTTTTCA GTAACTACTG ATTACTCATT TTATCCATTT GCATCAGCTT GCTTTATGGA
CAAGCTAGAA CCACAAATTG TTTCTCAAAA AAACAAAAAC AAAAACAGAG AGGCTAGATC CACCAATTAT CTGTTACAAG
CTTTTTGGAC TTCCTGCCTT GGTATGTTGA TCTTTCAATC TGAACTGCTC CATTTTTTCT CTGGGTGGAG CCTGGGAGCC
TTTCACCATC CCAAAAAGCA AGAAATGTGT TTCACGCGAG AGATCGACAA GAAACGACTA GGTCCCATTT ACTAGGTTTA
TGGCCCCATC ACTGCCCCTG ATAATGACAT TCACCAGAAC TTTTAGCTGG TAGTCCAGTA CCCACATCTG TGCCTGGTAC
TAACCTGGGA CCAACAAATA CTTATTGGAT ATGCCAGCTT AGTGTTGCAA CTTGCAAGGA GTGTGAGTCA TCTCAATAGA
TACAGGCCTT CAATTCAGAC CCCCCAAAAA AGTATTCCTT TTCTTTCTGT TGAGCTGTCT AAATCATCTC CAGTTGCAGG
ATCATAGAAT ACACCAGGCA CAAGCAACTA AAGATGATCT ACGATTTTTA GACAATAGAT CTTCATTGAC CCGGCTTTTG
CGAGAAAGAC AGAAACAAAC ACGAGTACAG AGTTCAGAAC AGAACTGAAG ATGATAAATT CAGAGCCCCC CCAAAAAGTG
TCCCTTTTAA TCTGTTGGGC AGTCTAATTC TAAATTATTC TCTCCAAATT GCAGGATCAT ATATATGAAT ACCTGATATT
CTGATGATGC ATATGATTTG TGATGATTTT CAGGTGTGGA TCCAGCCTGT GCCGTCGTGT CCTCCAACTC GAATGGAGCC
CCGGATCTTC GGCGTGCTCT CTCTCTTCTG TCAAGCGATT CCTGGGGCCC GGCCGACGTT CAGGCCGGCT CCCAGGTGCA
TCCCGGTGGA GTGATGCCGC CCCTCGCCGT TGCCGCCGCC ACCGTCACCG CCCCGACGAA CCCTGTCAGT GTGATGCATG
CTCTGCACCC GTCCACCGGA GGAGGAGGAT TCTGGCAAGA CGGCGACGAC CCGCCTCCGC TCGATCATGC CTCGCAGGCT
CAGGCGTTCA TGCATCCTGG CAATGGCAGC AGCTCCGGCT ATGGCCATCT GCACTGATTC TGCTGCATCT ATTTGGAACG
GGTTGATGAC TGGTTACTCC GTTCATGATC TTACCCTGTC AGTGATGGAC TCTGAATAAT TTGGGGGCGA ATTGTCCTGC
AACCCCAGGA TTTATTATTT CTATTTTTGA AACCAAACCA CCAGGATATT TGCCATTGGA TGAGAAGTGT TCATGATCAT
GAAATGATCT GTTTTGTTCC ACAGAATCTG ACATATCTAC TACTCGTCTT GGGAATGAGC TGAGATCGAT TCGTGTGTTG
TTCATTCAGG 

Locus: Os06g0703500

Loading...

Locus: Os06g0703500

Loading...