Os06t0703500-02

Locus

Os06g0703500

Description

Similar to SBP-domain protein 5 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SPL12

CGSNL Gene Name

RICE SQUAMOSA PROMOTER-BINDING-LIKE 12

Oryzabase Gene Symbol Synonym(s)

OsSPL12, DLN176, OsDLN176

Oryzabase Gene Name Synonym(s)

Squamosa promoter-binding-like protein 12, SQUAMOSA Promoter-Binding Protein-Like 12a, DLN repressor 176, DLN motif protein 176

Transcript Evidence

AK073179 (DDBJ, Best hit)

Protein Evidence

Q5Z818 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcription factor, SBP-box (IPR004333)

Full-length cDNA

J033004F21 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0703500-02)

RiceXPro (AK073179)

Others

Oryzabase (6895)

KEGG (Os06t0703500-02)

Transcript

2506 bp

>Os06t0703500-02 Similar to SBP-domain protein 5 (Fragment).
ATAGTCACTACTCACTACACTACCAGTTGGTGTTTGTTCTGAGCATTATTGGAGTGTCAG
GGAAGGGCATGTGCTTTTGTTGGTTGCTGTAGGAGGAGGCAGCCATCCACTGGGCCTCAC
TCTCCTCTTGTTGCTGCCTCCTCCTCTTGTTACTGTTCAGTCTCAGGCTCTCAGGCTCAC
AGGTGGGGTTTTGGGAGATACTAGTTAGGAGGGAAAGGTTGCCATCTTGTGTGTGTTGGA
TCTTTAATACAACGGGGATAACGATTCTCTCTCAGCTAAAGGAGGTGAGATTCTTGGTTT
CACATCAAGTATTATTGTTCTTTCTTTTACTTCCTTCAAAATAGTTTCTTTGCTTTTTAT
TTCATATATGGTTTGGTTTATTTATGCTCCCCAACAAGCAACTGGTTCATGTGCGGTAAC
AAGGAGCAAATAATGCAGCTCTGATTGACTTGGGGTAGTTGTTGTGGTGATAGATTGGAA
AGGGTTTAAATAGCGGGTGGTTGTGGTGATGAATGGGGGCCAGCCTTGATGGGGTTGATG
CTGTCGTCTTTTAGGTCGGGGAAACAAGTGGGATAGGATCTCTCTCAAGTCGAGGTGAGT
GAGAACTCAGCCAAGAACAACAATGGAGTCTCTGTTGCTTTAGTTCTGCCAGCCAATTGG
TTTCAACTTTCAACGCTGCTACTTGTTATTCATCACCTCCTCGGATCGGTTTGATTTATG
CTCAAGGTTGTGCTATGCATGGTCATGCTGATTGAGGGCAAGATTTGCAGGGAGAGGAAG
GATCCACTGTGTTTCTTTTCTGGGAGAAAGGAAAGTTGAGATTTGCAATATATACAAGTG
TGAGCAGCAGCAGTTGAGATCCTTAATTCAGCCATGGCTTCTTTTGGGATGAACTGGAAT
CAGAAGAGCCCTGTGTTTTGGGACTGGGAAAATCCAGCGCCTTTCGGTCCGAATACAATG
GAAAATCCCAAGAGCATACCTCACCCTGAACCAAGAGGTGTAGTTGTCGCGGCCGCAAAT
CATGGATCCACCAATTCATCCGGTGGCACGTTCACTTCTAGCTCGGAGCTAGCCAATGGT
TCATCGAAGAGCTCCTTGTCAGCGTCGTTCGATTCCTCATCCAAGCTGGGGAACAGCTTA
GAGTTCAGGTTTGCTTCTGTCAAAGGGCATGGCAAGAACATGTGCAAGGATGGCGAGGCC
GGTAGAGTTGAAGACTCGGGCACTTCTCCAGCTGTGGCAGTTAGCCATGGTGAGCCGGTA
ATAGGACTCAAGTTAGGGAAGAGAACTTACTTTGAAAATGTTTGTGGAGGGCAGAATGTC
AAGAGCTCCTCTGCAGCTTCAGGTGTGACTTGTCCATCTACTGTGGTCAAGAAGATGAAG
GTGTCTCAGCAGAGCACACAAAGCTCATACTGCCAAGTTGAAGGCTGCAAAGTCGATCTG
TCCTCCGCAAGAGAATACCATCGCAAGCACAAAGTTTGTGAAGCTCATTCTAAGGCACCA
AAGGTTATTGTTTCTGGTCTGGAGCGCCGTTTTTGCCAACAGTGTAGTCGGTTTCATGGT
TTAGCTGAATTTGACCAGAAAAAGAAAAGTTGCCGCAGGCGTCTATCTGATCATAATGCA
CGAAGAAGGAAACCGCAACAAGAGGCAATTTCATTTGGTTCATCAAGGCTCGCCACGATG
TTTTACGATGCAAGGCAGCAGACAGATATTTACTTTGGCCAATCTCCTTTTGGCCAAGTG
AGAAGCAATGCAATTTCTTCATGTGACAACCTGGGAGGCTTCAAATTTACAGAAGCAAAA
CTCCCCTGGATGAAGCCAATGAAAACTATAGGCCTTGAGGATCTGAATTTCTCTACCCTG
CAGATGCCAGGCAATGTTGTGTCGCATACGGTGCATCATCATGATTTTGATGGGCTCATA
CCATTCAAGGGAAACACCCCGAAGGTCCTCAACCAAGGTGTGGATCCAGCCTGTGCCGTC
GTGTCCTCCAACTCGAATGGAGCCCCGGATCTTCGGCGTGCTCTCTCTCTTCTGTCAAGC
GATTCCTGGGGCCCGGCCGACGTTCAGGCCGGCTCCCAGGTGCATCCCGGTGGAGTGATG
CCGCCCCTCGCCGTTGCCGCCGCCACCGTCACCGCCCCGACGAACCCTGTCAGTGTGATG
CATGCTCTGCACCCGTCCACCGGAGGAGGAGGATTCTGGCAAGACGGCGACGACCCGCCT
CCGCTCGATCATGCCTCGCAGGCTCAGGCGTTCATGCATCCTGGCAATGGCAGCAGCTCC
GGCTATGGCCATCTGCACTGATTCTGCTGCATCTATTTGGAACGGGTTGATGACTGGTTA
CTCCGTTCATGATCTTACCCTGTCAGTGATGGACTCTGAATAATTTGGGGGCGAATTGTC
CTGCAACCCCAGGATTTATTATTTCTATTTTTGAAACCAAACCACCAGGATATTTGCCAT
TGGATGAGAAGTGTTCATGATCATGAAATGATCTGTTTTGTTCCAC

CDS

1428 bp

>Os06t0703500-02 Similar to SBP-domain protein 5 (Fragment).
ATGGCTTCTTTTGGGATGAACTGGAATCAGAAGAGCCCTGTGTTTTGGGACTGGGAAAAT
CCAGCGCCTTTCGGTCCGAATACAATGGAAAATCCCAAGAGCATACCTCACCCTGAACCA
AGAGGTGTAGTTGTCGCGGCCGCAAATCATGGATCCACCAATTCATCCGGTGGCACGTTC
ACTTCTAGCTCGGAGCTAGCCAATGGTTCATCGAAGAGCTCCTTGTCAGCGTCGTTCGAT
TCCTCATCCAAGCTGGGGAACAGCTTAGAGTTCAGGTTTGCTTCTGTCAAAGGGCATGGC
AAGAACATGTGCAAGGATGGCGAGGCCGGTAGAGTTGAAGACTCGGGCACTTCTCCAGCT
GTGGCAGTTAGCCATGGTGAGCCGGTAATAGGACTCAAGTTAGGGAAGAGAACTTACTTT
GAAAATGTTTGTGGAGGGCAGAATGTCAAGAGCTCCTCTGCAGCTTCAGGTGTGACTTGT
CCATCTACTGTGGTCAAGAAGATGAAGGTGTCTCAGCAGAGCACACAAAGCTCATACTGC
CAAGTTGAAGGCTGCAAAGTCGATCTGTCCTCCGCAAGAGAATACCATCGCAAGCACAAA
GTTTGTGAAGCTCATTCTAAGGCACCAAAGGTTATTGTTTCTGGTCTGGAGCGCCGTTTT
TGCCAACAGTGTAGTCGGTTTCATGGTTTAGCTGAATTTGACCAGAAAAAGAAAAGTTGC
CGCAGGCGTCTATCTGATCATAATGCACGAAGAAGGAAACCGCAACAAGAGGCAATTTCA
TTTGGTTCATCAAGGCTCGCCACGATGTTTTACGATGCAAGGCAGCAGACAGATATTTAC
TTTGGCCAATCTCCTTTTGGCCAAGTGAGAAGCAATGCAATTTCTTCATGTGACAACCTG
GGAGGCTTCAAATTTACAGAAGCAAAACTCCCCTGGATGAAGCCAATGAAAACTATAGGC
CTTGAGGATCTGAATTTCTCTACCCTGCAGATGCCAGGCAATGTTGTGTCGCATACGGTG
CATCATCATGATTTTGATGGGCTCATACCATTCAAGGGAAACACCCCGAAGGTCCTCAAC
CAAGGTGTGGATCCAGCCTGTGCCGTCGTGTCCTCCAACTCGAATGGAGCCCCGGATCTT
CGGCGTGCTCTCTCTCTTCTGTCAAGCGATTCCTGGGGCCCGGCCGACGTTCAGGCCGGC
TCCCAGGTGCATCCCGGTGGAGTGATGCCGCCCCTCGCCGTTGCCGCCGCCACCGTCACC
GCCCCGACGAACCCTGTCAGTGTGATGCATGCTCTGCACCCGTCCACCGGAGGAGGAGGA
TTCTGGCAAGACGGCGACGACCCGCCTCCGCTCGATCATGCCTCGCAGGCTCAGGCGTTC
ATGCATCCTGGCAATGGCAGCAGCTCCGGCTATGGCCATCTGCACTGA

Protein

475 aa

>Os06t0703500-02 Similar to SBP-domain protein 5 (Fragment).
MASFGMNWNQKSPVFWDWENPAPFGPNTMENPKSIPHPEPRGVVVAAANHGSTNSSGGTF
TSSSELANGSSKSSLSASFDSSSKLGNSLEFRFASVKGHGKNMCKDGEAGRVEDSGTSPA
VAVSHGEPVIGLKLGKRTYFENVCGGQNVKSSSAASGVTCPSTVVKKMKVSQQSTQSSYC
QVEGCKVDLSSAREYHRKHKVCEAHSKAPKVIVSGLERRFCQQCSRFHGLAEFDQKKKSC
RRRLSDHNARRRKPQQEAISFGSSRLATMFYDARQQTDIYFGQSPFGQVRSNAISSCDNL
GGFKFTEAKLPWMKPMKTIGLEDLNFSTLQMPGNVVSHTVHHHDFDGLIPFKGNTPKVLN
QGVDPACAVVSSNSNGAPDLRRALSLLSSDSWGPADVQAGSQVHPGGVMPPLAVAAATVT
APTNPVSVMHALHPSTGGGGFWQDGDDPPPLDHASQAQAFMHPGNGSSSGYGHLH*

5'UTR

chr06:29708016..29708260 (- strand) : 245 bp

chr06:29707329..29707903 (- strand) : 575 bp

chr06:29707061..29707113 (- strand) : 53 bp

CDS

chr06:29706384..29707060 (- strand) : 677 bp

chr06:29705999..29706135 (- strand) : 137 bp

chr06:29705354..29705623 (- strand) : 270 bp

chr06:29703831..29704174 (- strand) : 344 bp

3'UTR

chr06:29703626..29703830 (- strand) : 205 bp

FASTA

>Os06t0703500-02 class=Sequence position=chr06:29703626..29708260 (- strand)
ATAGTCACTA CTCACTACAC TACCAGTTGG TGTTTGTTCT GAGCATTATT GGAGTGTCAG GGAAGGGCAT GTGCTTTTGT
TGGTTGCTGT AGGAGGAGGC AGCCATCCAC TGGGCCTCAC TCTCCTCTTG TTGCTGCCTC CTCCTCTTGT TACTGTTCAG
TCTCAGGCTC TCAGGCTCAC AGGTGGGGTT TTGGGAGATA CTAGTTAGGA GGGAAAGGTT GCCATCTTGT GTGTGTTGGA
TCTTTGTGAG TCATGTCCTC TTTATCTTGG TGCTTTTGCT TTTTCTTGTG TTTTTTCTTT TCTTTCTCCT ATCTTCTTTT
GCCACAAAAC TTATGGCTAT TGTTTTCATC CAGGTAGAAT ACAACGGGGA TAACGATTCT CTCTCAGCTA AAGGAGGTGA
GATTCTTGGT TTCACATCAA GTATTATTGT TCTTTCTTTT ACTTCCTTCA AAATAGTTTC TTTGCTTTTT ATTTCATATA
TGGTTTGGTT TATTTATGCT CCCCAACAAG CAACTGGTTC ATGTGCGGTA ACAAGGAGCA AATAATGCAG CTCTGATTGA
CTTGGGGTAG TTGTTGTGGT GATAGATTGG AAAGGGTTTA AATAGCGGGT GGTTGTGGTG ATGAATGGGG GCCAGCCTTG
ATGGGGTTGA TGCTGTCGTC TTTTAGGTCG GGGAAACAAG TGGGATAGGA TCTCTCTCAA GTCGAGGTGA GTGAGAACTC
AGCCAAGAAC AACAATGGAG TCTCTGTTGC TTTAGTTCTG CCAGCCAATT GGTTTCAACT TTCAACGCTG CTACTTGTTA
TTCATCACCT CCTCGGATCG GTTTGATTTA TGCTCAAGGT TGTGCTATGC ATGGTCATGC TGATTGAGGG CAAGATTTGC
AGGGAGAGGA AGGATCCACT GTGTTTCTTT TCTGGGAGAA AGGAAAGTTG AGGTAATTGA TCGTTTTCGC CTTTCTTCTC
TTGCTATGAT CCCCACAATA AAGCGCGTAT AATTCATTTT GGATGGTATG TTGTACTTGT CTTTTTATCT GAAAGACAAA
ATGATTTTGG TACCCGAGAT ATGTTTATTG CCTTTCTCAT CCAAGTTCTG CAATTTGTTG TGACGTGTGT TCTTTCTGTT
CCTTCTTGTT TCTTGAAATC CTATCAGATT TGCAATATAT ACAAGTGTGA GCAGCAGCAG TTGAGATCCT TAATTCAGCC
ATGGCTTCTT TTGGGATGAA CTGGAATCAG AAGAGCCCTG TGTTTTGGGA CTGGGAAAAT CCAGCGCCTT TCGGTCCGAA
TACAATGGAA AATCCCAAGA GCATACCTCA CCCTGAACCA AGAGGTGTAG TTGTCGCGGC CGCAAATCAT GGATCCACCA
ATTCATCCGG TGGCACGTTC ACTTCTAGCT CGGAGCTAGC CAATGGTTCA TCGAAGAGCT CCTTGTCAGC GTCGTTCGAT
TCCTCATCCA AGCTGGGGAA CAGCTTAGAG TTCAGGTTTG CTTCTGTCAA AGGGCATGGC AAGAACATGT GCAAGGATGG
CGAGGCCGGT AGAGTTGAAG ACTCGGGCAC TTCTCCAGCT GTGGCAGTTA GCCATGGTGA GCCGGTAATA GGACTCAAGT
TAGGGAAGAG AACTTACTTT GAAAATGTTT GTGGAGGGCA GAATGTCAAG AGCTCCTCTG CAGCTTCAGG TGTGACTTGT
CCATCTACTG TGGTCAAGAA GATGAAGGTG TCTCAGCAGA GCACACAAAG CTCATACTGC CAAGTTGAAG GCTGCAAAGT
CGATCTGTCC TCCGCAAGAG AATACCATCG CAAGCACAAA GTTTGTGAAG CTCATTCTAA GGCACCAAAG GTTATTGTTT
CTGGTCTGGA GCGCCGTTTT TGCCAACAGT GTAGTCGGTG AGAGCATAAT CTTATTTCAC TTTGCATGCT TTCAAGACTT
CCTTTTTTAT ATGCACTACC CTCTTTAAAT CAATAGACAC AACAACAATG AAGAAAATTG TCTCTATCTG TATTGCATAA
AGCATATACC AGTATAAATA AAGTCAAAGA AGTAGCACTA GTTTGCTTGG ATTAAAGTAC AACGCAAGGT TCGAGGTTAT
TGATCTTTAC TAGTTTGCTG TCTTATGTAC TCTATTGTTT TGTAGGTTTC ATGGTTTAGC TGAATTTGAC CAGAAAAAGA
AAAGTTGCCG CAGGCGTCTA TCTGATCATA ATGCACGAAG AAGGAAACCG CAACAAGAGG CAATTTCATT TGGTTCATCA
AGGCTCGCCA CGATGTTTTA CGGTAGTACT GACCCCTTAG ATGCATCACA ATGCTAGATG CCTTGTTCTG TTTTGATGAC
TGAAAGCTAT TCCTTTAACC CAATCAATAC TGCTGAAATA GTAGGATGAT ACCGTAAGCA TTTTAACATG TAACATATCC
AGTTTTCTGC ATACGCACGA CTGGTGGGTG TTACCTGGTG GCACACTTCT TTTTAGAAGG GAGCTTAACC CATCCTCTTG
AGTCTTGACA GTTACTATTA TATTGTTATA TAATAATGCA TAGTAATCAT ATATGGTAGC TTGTGTATTT TCATGATGTA
GTTTTCCACT TGACGCGTTT TTACCAAGTC CTACACAAAT CTTTCATGGT GACAGTGTTT GCGATTTTGC ATTGCAGATG
CAAGGCAGCA GACAGATATT TACTTTGGCC AATCTCCTTT TGGCCAAGTG AGAAGCAATG CAATTTCTTC ATGTGACAAC
CTGGGAGGCT TCAAATTTAC AGAAGCAAAA CTCCCCTGGA TGAAGCCAAT GAAAACTATA GGCCTTGAGG ATCTGAATTT
CTCTACCCTG CAGATGCCAG GCAATGTTGT GTCGCATACG GTGCATCATC ATGATTTTGA TGGGCTCATA CCATTCAAGG
GAAACACCCC GAAGGTCCTC AACCAAGGTA CATTAACATC TCTCAATTCA TCACTGAACT TTAAAGAAAA GACATGCAGC
TGTTGCAGCA TCTTCAATTT TAAGTTTTTA ACCATGTGTT TTTATTTAAT GATCTAAATG GGACTACCTA TTTTAGCAAT
TCAATTTCTT ATCAGTAAAT AGGTCCGACT GATTTGACCT TTTGTTTGAT TGTTATCTGT ACTGTTCACC TCTCTGCTAT
TCGACAACGC CGAGACAGCA TTTTATTCTC CATAATTCCT TTTCATACGG CTACAATCTT CTGAAAAGTC TTTGTTGCTA
AACAGTCAGC ATTCCTGACT TGGAGTTTGG ATTAAACAAG CTACTTAGTC ATAAGAACAC ATCATTTTGC TCCCTTTTTT
TCAGTAACTA CTGATTACTC ATTTTATCCA TTTGCATCAG CTTGCTTTAT GGACAAGCTA GAACCACAAA TTGTTTCTCA
AAAAAACAAA AACAAAAACA GAGAGGCTAG ATCCACCAAT TATCTGTTAC AAGCTTTTTG GACTTCCTGC CTTGGTATGT
TGATCTTTCA ATCTGAACTG CTCCATTTTT TCTCTGGGTG GAGCCTGGGA GCCTTTCACC ATCCCAAAAA GCAAGAAATG
TGTTTCACGC GAGAGATCGA CAAGAAACGA CTAGGTCCCA TTTACTAGGT TTATGGCCCC ATCACTGCCC CTGATAATGA
CATTCACCAG AACTTTTAGC TGGTAGTCCA GTACCCACAT CTGTGCCTGG TACTAACCTG GGACCAACAA ATACTTATTG
GATATGCCAG CTTAGTGTTG CAACTTGCAA GGAGTGTGAG TCATCTCAAT AGATACAGGC CTTCAATTCA GACCCCCCAA
AAAAGTATTC CTTTTCTTTC TGTTGAGCTG TCTAAATCAT CTCCAGTTGC AGGATCATAG AATACACCAG GCACAAGCAA
CTAAAGATGA TCTACGATTT TTAGACAATA GATCTTCATT GACCCGGCTT TTGCGAGAAA GACAGAAACA AACACGAGTA
CAGAGTTCAG AACAGAACTG AAGATGATAA ATTCAGAGCC CCCCCAAAAA GTGTCCCTTT TAATCTGTTG GGCAGTCTAA
TTCTAAATTA TTCTCTCCAA ATTGCAGGAT CATATATATG AATACCTGAT ATTCTGATGA TGCATATGAT TTGTGATGAT
TTTCAGGTGT GGATCCAGCC TGTGCCGTCG TGTCCTCCAA CTCGAATGGA GCCCCGGATC TTCGGCGTGC TCTCTCTCTT
CTGTCAAGCG ATTCCTGGGG CCCGGCCGAC GTTCAGGCCG GCTCCCAGGT GCATCCCGGT GGAGTGATGC CGCCCCTCGC
CGTTGCCGCC GCCACCGTCA CCGCCCCGAC GAACCCTGTC AGTGTGATGC ATGCTCTGCA CCCGTCCACC GGAGGAGGAG
GATTCTGGCA AGACGGCGAC GACCCGCCTC CGCTCGATCA TGCCTCGCAG GCTCAGGCGT TCATGCATCC TGGCAATGGC
AGCAGCTCCG GCTATGGCCA TCTGCACTGA TTCTGCTGCA TCTATTTGGA ACGGGTTGAT GACTGGTTAC TCCGTTCATG
ATCTTACCCT GTCAGTGATG GACTCTGAAT AATTTGGGGG CGAATTGTCC TGCAACCCCA GGATTTATTA TTTCTATTTT
TGAAACCAAA CCACCAGGAT ATTTGCCATT GGATGAGAAG TGTTCATGAT CATGAAATGA TCTGTTTTGT TCCAC

Locus: Os06g0703500

Loading...

Locus: Os06g0703500

Loading...