Os06t0703500-03

Locus

Os06g0703500

Description

Similar to Squamosa promoter-binding-like protein 12.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SPL12

CGSNL Gene Name

RICE SQUAMOSA PROMOTER-BINDING-LIKE 12

Oryzabase Gene Symbol Synonym(s)

OsSPL12, DLN176, OsDLN176

Oryzabase Gene Name Synonym(s)

Squamosa promoter-binding-like protein 12, SQUAMOSA Promoter-Binding Protein-Like 12a, DLN repressor 176, DLN motif protein 176

Transcript Evidence

AK061641 (DDBJ, Best hit)

Protein Evidence

Q5Z818 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcription factor, SBP-box (IPR004333)

Full-length cDNA

001-036-B03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0703500-03)

RiceXPro (AK061641)

Others

Oryzabase (6895)

KEGG (Os06t0703500-03)

Transcript

1571 bp

>Os06t0703500-03 Similar to Squamosa promoter-binding-like protein 12.
CCAGCGCCTTTCGGTCCGAATACAATGGAAAATCCCAAGAGCATACCTCACCCTGAACCA
AGAGGTGTAGTTGTCGCGGCCGCAAATCATGGATCCACCAATTCATCCGGTGGCACGTTC
ACTTCTAGCTCGGAGCTAGCCAATGGTTCATCGAAGAGCTCCTTGTCAGCGTCGTTCGAT
TCCTCATCCAAGCTGGGGAACAGCTTAGAGTTCAGGTTTGCTTCTGTCAAAGGGCATGGC
AAGAACATGTGCAAGGATGGCGAGGCCGGTAGAGTTGAAGACTCGGGCACTTCTCCAGCT
GTGGCAGTTAGCCATGGTGAGCCGGTAATAGGACTCAAGTTAGGGAAGAGAACTTACTTT
GAAAATGTTTGTGGAGGGCAGAATGTCAAGAGCTCCTCTGCAGCTTCAGGTGTGACTTGT
CCATCTACTGTGGTCAAGAAGATGAAGGTGTCTCAGCAGAGCACACAAAGCTCATACTGC
CAAGTTGAAGGCTGCAAAGTCGATCTGTCCTCCGCAAGAGAATACCATCGCAAGCACAAA
GTTTGTGAAGCTCATTCTAAGGCACCAAAGGTTATTGTTTCTGGTCTGGAGCGCCGTTTT
TGCCAACAGTGTAGTCGGTTTCATGGTTTAGCTGAATTTGACCAGAAAAAGAAAAGTTGC
CGCAGGCGTCTATCTGATCATAATGCACGAAGAAGGAAACCGCAACAAGAGGCAATTTCA
TTTGGTTCATCAAGGCTCGCCACGATGTTTTACGATGCAAGGCAGCAGACAGATATTTAC
TTTGGCCAATCTCCTTTTGGCCAAGTGAGAAGCAATGCAATTTCTTCATGTGACAACCTG
GGAGGCTTCAAATTTACAGAAGCAAAACTCCCCTGGATGAAGCCAATGAAAACTATAGGC
CTTGAGGATCTGAATTTCTCTACCCTGCAGATGCCAGGCAATGTTGTGTCGCATACGGTG
CATCATCATGATTTTGATGGGCTCATACCATTCAAGGGAAACACCCCGAAGGTCCTCAAC
CAAGGTGTGGATCCAGCCTGTGCCGTCGTGTCCTCCAACTCGAATGGAGCCCCGGATCTT
CGGCGTGCTCTCTCTCTTCTGTCAAGCGATTCCTGGGGCCCGGCCGACGTTCAGGCCGGC
TCCCAGGTGCATCCCGGTGGAGTGATGCCGCCCCTCGCCGTTGCCGCCGCCACCGTCACC
GCCCCGACGAACCCTGTCAGTGTGATGCATGCTCTGCACCCGTCCACCGGAGGAGGAGGA
TTCTGGCAAGACGGCGACGACCCGCCTCCGCTCGATCATGCCTCGCAGGCTCAGGCGTTC
ATGCATCCTGGCAATGGCAGCAGCTCCGGCTATGGCCATCTGCACTGATTCTGCTGCATC
TATTTGGAACGGGTTGATGACTGGTTACTCCGTTCATGATCTTACCCTGTCAGTGATGGA
CTCTGAATAATTTGGGGGCGAATTGTCCTGCAACCCCAGGATTTATTATTTCTATTTTTG
AAACCAAACCACCAGGATATTTGCCATTGGATGAGAAGTGTTCATGATCATGAAATGATC
TGTTTTGTTCC

CDS

1368 bp

>Os06t0703500-03 Similar to Squamosa promoter-binding-like protein 12.
CCAGCGCCTTTCGGTCCGAATACAATGGAAAATCCCAAGAGCATACCTCACCCTGAACCA
AGAGGTGTAGTTGTCGCGGCCGCAAATCATGGATCCACCAATTCATCCGGTGGCACGTTC
ACTTCTAGCTCGGAGCTAGCCAATGGTTCATCGAAGAGCTCCTTGTCAGCGTCGTTCGAT
TCCTCATCCAAGCTGGGGAACAGCTTAGAGTTCAGGTTTGCTTCTGTCAAAGGGCATGGC
AAGAACATGTGCAAGGATGGCGAGGCCGGTAGAGTTGAAGACTCGGGCACTTCTCCAGCT
GTGGCAGTTAGCCATGGTGAGCCGGTAATAGGACTCAAGTTAGGGAAGAGAACTTACTTT
GAAAATGTTTGTGGAGGGCAGAATGTCAAGAGCTCCTCTGCAGCTTCAGGTGTGACTTGT
CCATCTACTGTGGTCAAGAAGATGAAGGTGTCTCAGCAGAGCACACAAAGCTCATACTGC
CAAGTTGAAGGCTGCAAAGTCGATCTGTCCTCCGCAAGAGAATACCATCGCAAGCACAAA
GTTTGTGAAGCTCATTCTAAGGCACCAAAGGTTATTGTTTCTGGTCTGGAGCGCCGTTTT
TGCCAACAGTGTAGTCGGTTTCATGGTTTAGCTGAATTTGACCAGAAAAAGAAAAGTTGC
CGCAGGCGTCTATCTGATCATAATGCACGAAGAAGGAAACCGCAACAAGAGGCAATTTCA
TTTGGTTCATCAAGGCTCGCCACGATGTTTTACGATGCAAGGCAGCAGACAGATATTTAC
TTTGGCCAATCTCCTTTTGGCCAAGTGAGAAGCAATGCAATTTCTTCATGTGACAACCTG
GGAGGCTTCAAATTTACAGAAGCAAAACTCCCCTGGATGAAGCCAATGAAAACTATAGGC
CTTGAGGATCTGAATTTCTCTACCCTGCAGATGCCAGGCAATGTTGTGTCGCATACGGTG
CATCATCATGATTTTGATGGGCTCATACCATTCAAGGGAAACACCCCGAAGGTCCTCAAC
CAAGGTGTGGATCCAGCCTGTGCCGTCGTGTCCTCCAACTCGAATGGAGCCCCGGATCTT
CGGCGTGCTCTCTCTCTTCTGTCAAGCGATTCCTGGGGCCCGGCCGACGTTCAGGCCGGC
TCCCAGGTGCATCCCGGTGGAGTGATGCCGCCCCTCGCCGTTGCCGCCGCCACCGTCACC
GCCCCGACGAACCCTGTCAGTGTGATGCATGCTCTGCACCCGTCCACCGGAGGAGGAGGA
TTCTGGCAAGACGGCGACGACCCGCCTCCGCTCGATCATGCCTCGCAGGCTCAGGCGTTC
ATGCATCCTGGCAATGGCAGCAGCTCCGGCTATGGCCATCTGCACTGA

Protein

455 aa

>Os06t0703500-03 Similar to Squamosa promoter-binding-like protein 12.
PAPFGPNTMENPKSIPHPEPRGVVVAAANHGSTNSSGGTFTSSSELANGSSKSSLSASFD
SSSKLGNSLEFRFASVKGHGKNMCKDGEAGRVEDSGTSPAVAVSHGEPVIGLKLGKRTYF
ENVCGGQNVKSSSAASGVTCPSTVVKKMKVSQQSTQSSYCQVEGCKVDLSSAREYHRKHK
VCEAHSKAPKVIVSGLERRFCQQCSRFHGLAEFDQKKKSCRRRLSDHNARRRKPQQEAIS
FGSSRLATMFYDARQQTDIYFGQSPFGQVRSNAISSCDNLGGFKFTEAKLPWMKPMKTIG
LEDLNFSTLQMPGNVVSHTVHHHDFDGLIPFKGNTPKVLNQGVDPACAVVSSNSNGAPDL
RRALSLLSSDSWGPADVQAGSQVHPGGVMPPLAVAAATVTAPTNPVSVMHALHPSTGGGG
FWQDGDDPPPLDHASQAQAFMHPGNGSSSGYGHLH*

CDS

chr06:29706384..29707000 (- strand) : 617 bp

chr06:29705999..29706135 (- strand) : 137 bp

chr06:29705354..29705623 (- strand) : 270 bp

chr06:29703831..29704174 (- strand) : 344 bp

3'UTR

chr06:29703628..29703830 (- strand) : 203 bp

FASTA

>Os06t0703500-03 class=Sequence position=chr06:29703628..29707000 (- strand)
CCAGCGCCTT TCGGTCCGAA TACAATGGAA AATCCCAAGA GCATACCTCA CCCTGAACCA AGAGGTGTAG TTGTCGCGGC
CGCAAATCAT GGATCCACCA ATTCATCCGG TGGCACGTTC ACTTCTAGCT CGGAGCTAGC CAATGGTTCA TCGAAGAGCT
CCTTGTCAGC GTCGTTCGAT TCCTCATCCA AGCTGGGGAA CAGCTTAGAG TTCAGGTTTG CTTCTGTCAA AGGGCATGGC
AAGAACATGT GCAAGGATGG CGAGGCCGGT AGAGTTGAAG ACTCGGGCAC TTCTCCAGCT GTGGCAGTTA GCCATGGTGA
GCCGGTAATA GGACTCAAGT TAGGGAAGAG AACTTACTTT GAAAATGTTT GTGGAGGGCA GAATGTCAAG AGCTCCTCTG
CAGCTTCAGG TGTGACTTGT CCATCTACTG TGGTCAAGAA GATGAAGGTG TCTCAGCAGA GCACACAAAG CTCATACTGC
CAAGTTGAAG GCTGCAAAGT CGATCTGTCC TCCGCAAGAG AATACCATCG CAAGCACAAA GTTTGTGAAG CTCATTCTAA
GGCACCAAAG GTTATTGTTT CTGGTCTGGA GCGCCGTTTT TGCCAACAGT GTAGTCGGTG AGAGCATAAT CTTATTTCAC
TTTGCATGCT TTCAAGACTT CCTTTTTTAT ATGCACTACC CTCTTTAAAT CAATAGACAC AACAACAATG AAGAAAATTG
TCTCTATCTG TATTGCATAA AGCATATACC AGTATAAATA AAGTCAAAGA AGTAGCACTA GTTTGCTTGG ATTAAAGTAC
AACGCAAGGT TCGAGGTTAT TGATCTTTAC TAGTTTGCTG TCTTATGTAC TCTATTGTTT TGTAGGTTTC ATGGTTTAGC
TGAATTTGAC CAGAAAAAGA AAAGTTGCCG CAGGCGTCTA TCTGATCATA ATGCACGAAG AAGGAAACCG CAACAAGAGG
CAATTTCATT TGGTTCATCA AGGCTCGCCA CGATGTTTTA CGGTAGTACT GACCCCTTAG ATGCATCACA ATGCTAGATG
CCTTGTTCTG TTTTGATGAC TGAAAGCTAT TCCTTTAACC CAATCAATAC TGCTGAAATA GTAGGATGAT ACCGTAAGCA
TTTTAACATG TAACATATCC AGTTTTCTGC ATACGCACGA CTGGTGGGTG TTACCTGGTG GCACACTTCT TTTTAGAAGG
GAGCTTAACC CATCCTCTTG AGTCTTGACA GTTACTATTA TATTGTTATA TAATAATGCA TAGTAATCAT ATATGGTAGC
TTGTGTATTT TCATGATGTA GTTTTCCACT TGACGCGTTT TTACCAAGTC CTACACAAAT CTTTCATGGT GACAGTGTTT
GCGATTTTGC ATTGCAGATG CAAGGCAGCA GACAGATATT TACTTTGGCC AATCTCCTTT TGGCCAAGTG AGAAGCAATG
CAATTTCTTC ATGTGACAAC CTGGGAGGCT TCAAATTTAC AGAAGCAAAA CTCCCCTGGA TGAAGCCAAT GAAAACTATA
GGCCTTGAGG ATCTGAATTT CTCTACCCTG CAGATGCCAG GCAATGTTGT GTCGCATACG GTGCATCATC ATGATTTTGA
TGGGCTCATA CCATTCAAGG GAAACACCCC GAAGGTCCTC AACCAAGGTA CATTAACATC TCTCAATTCA TCACTGAACT
TTAAAGAAAA GACATGCAGC TGTTGCAGCA TCTTCAATTT TAAGTTTTTA ACCATGTGTT TTTATTTAAT GATCTAAATG
GGACTACCTA TTTTAGCAAT TCAATTTCTT ATCAGTAAAT AGGTCCGACT GATTTGACCT TTTGTTTGAT TGTTATCTGT
ACTGTTCACC TCTCTGCTAT TCGACAACGC CGAGACAGCA TTTTATTCTC CATAATTCCT TTTCATACGG CTACAATCTT
CTGAAAAGTC TTTGTTGCTA AACAGTCAGC ATTCCTGACT TGGAGTTTGG ATTAAACAAG CTACTTAGTC ATAAGAACAC
ATCATTTTGC TCCCTTTTTT TCAGTAACTA CTGATTACTC ATTTTATCCA TTTGCATCAG CTTGCTTTAT GGACAAGCTA
GAACCACAAA TTGTTTCTCA AAAAAACAAA AACAAAAACA GAGAGGCTAG ATCCACCAAT TATCTGTTAC AAGCTTTTTG
GACTTCCTGC CTTGGTATGT TGATCTTTCA ATCTGAACTG CTCCATTTTT TCTCTGGGTG GAGCCTGGGA GCCTTTCACC
ATCCCAAAAA GCAAGAAATG TGTTTCACGC GAGAGATCGA CAAGAAACGA CTAGGTCCCA TTTACTAGGT TTATGGCCCC
ATCACTGCCC CTGATAATGA CATTCACCAG AACTTTTAGC TGGTAGTCCA GTACCCACAT CTGTGCCTGG TACTAACCTG
GGACCAACAA ATACTTATTG GATATGCCAG CTTAGTGTTG CAACTTGCAA GGAGTGTGAG TCATCTCAAT AGATACAGGC
CTTCAATTCA GACCCCCCAA AAAAGTATTC CTTTTCTTTC TGTTGAGCTG TCTAAATCAT CTCCAGTTGC AGGATCATAG
AATACACCAG GCACAAGCAA CTAAAGATGA TCTACGATTT TTAGACAATA GATCTTCATT GACCCGGCTT TTGCGAGAAA
GACAGAAACA AACACGAGTA CAGAGTTCAG AACAGAACTG AAGATGATAA ATTCAGAGCC CCCCCAAAAA GTGTCCCTTT
TAATCTGTTG GGCAGTCTAA TTCTAAATTA TTCTCTCCAA ATTGCAGGAT CATATATATG AATACCTGAT ATTCTGATGA
TGCATATGAT TTGTGATGAT TTTCAGGTGT GGATCCAGCC TGTGCCGTCG TGTCCTCCAA CTCGAATGGA GCCCCGGATC
TTCGGCGTGC TCTCTCTCTT CTGTCAAGCG ATTCCTGGGG CCCGGCCGAC GTTCAGGCCG GCTCCCAGGT GCATCCCGGT
GGAGTGATGC CGCCCCTCGC CGTTGCCGCC GCCACCGTCA CCGCCCCGAC GAACCCTGTC AGTGTGATGC ATGCTCTGCA
CCCGTCCACC GGAGGAGGAG GATTCTGGCA AGACGGCGAC GACCCGCCTC CGCTCGATCA TGCCTCGCAG GCTCAGGCGT
TCATGCATCC TGGCAATGGC AGCAGCTCCG GCTATGGCCA TCTGCACTGA TTCTGCTGCA TCTATTTGGA ACGGGTTGAT
GACTGGTTAC TCCGTTCATG ATCTTACCCT GTCAGTGATG GACTCTGAAT AATTTGGGGG CGAATTGTCC TGCAACCCCA
GGATTTATTA TTTCTATTTT TGAAACCAAA CCACCAGGAT ATTTGCCATT GGATGAGAAG TGTTCATGAT CATGAAATGA
TCTGTTTTGT TCC

Locus: Os06g0703500

Loading...

Locus: Os06g0703500

Loading...