Os06t0705400-01

Locus

Os06g0705400

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.6, OsLtpII.6

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.6, lipid transfer protein 2.6, type 2 non-specific lipid transfer protein 6

Transcript Evidence

AK062493 (DDBJ, Best hit)

Protein Evidence

C0KHK5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Full-length cDNA

001-103-H09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0705400-01)

RiceXPro (AK062493)

Others

Oryzabase (13534)

KEGG (Os06t0705400-01)

Transcript

437 bp

>Os06t0705400-01 Hypothetical conserved gene.
ATCACACGCACACTGACACACAGTCACACACCATCCCGCTCTCTCCATCGATCTCCATCA
CAAGCTAGCAAAACCAAGAGCCAAGTCGAGCAACACATCATACAATGGCGGGCATCAACC
GCAAGGGCGGCGCGGCGGCGGCGTACGCGGTGGCGCTGTGCCAGTACGCGCGCGACCCAT
CCTACCGCAGCTACGTCACGAGCCCCAGCGCGCAGCGCGCCGTCAAGGCGTGCAACGTCA
AGGCCAACTGCTAAATTAAACTGCTGCTACTACTCTACTAGTACTAATGCTTGTGCAGTT
TTGCTACTGCTACTGCTAGTAAATAAACGTGGTTGCCGCTAGCTAGGCAGCCATGATCAT
TGTGTGCATGTTTCAGTTCACTGTCACGTATGTATGGGGCTATATGAATGAAGTTCTGCT
ATGCTTGCTATCTCTTC

CDS

150 bp

>Os06t0705400-01 Hypothetical conserved gene.
ATGGCGGGCATCAACCGCAAGGGCGGCGCGGCGGCGGCGTACGCGGTGGCGCTGTGCCAG
TACGCGCGCGACCCATCCTACCGCAGCTACGTCACGAGCCCCAGCGCGCAGCGCGCCGTC
AAGGCGTGCAACGTCAAGGCCAACTGCTAA

Protein

50 aa

>Os06t0705400-01 Hypothetical conserved gene.
MAGINRKGGAAAAYAVALCQYARDPSYRSYVTSPSAQRAVKACNVKANC*

5'UTR

chr06:29807821..29807924 (+ strand) : 104 bp

CDS

chr06:29807925..29807975 (+ strand) : 51 bp

chr06:29808111..29808209 (+ strand) : 99 bp

3'UTR

chr06:29808210..29808392 (+ strand) : 183 bp

FASTA

>Os06t0705400-01 class=Sequence position=chr06:29807821..29808392 (+ strand)
ATCACACGCA CACTGACACA CAGTCACACA CCATCCCGCT CTCTCCATCG ATCTCCATCA CAAGCTAGCA AAACCAAGAG
CCAAGTCGAG CAACACATCA TACAATGGCG GGCATCAACC GCAAGGGCGG CGCGGCGGCG GCGTACGCGG TGGCGCTGTT
GCTTGCGGCG GGCGCGGCGG ATGCGGCGGG GTGCAACCCG TCGGCGCTGT CGCCGTGCAT GAGCGCGATC ATGCTGGGCG
CGGCGCCGTC GCCCGGCTGC TGCGTGCAGC TGCGGGCGCA GCAGCCGTGC CTGTGCCAGT ACGCGCGCGA CCCATCCTAC
CGCAGCTACG TCACGAGCCC CAGCGCGCAG CGCGCCGTCA AGGCGTGCAA CGTCAAGGCC AACTGCTAAA TTAAACTGCT
GCTACTACTC TACTAGTACT AATGCTTGTG CAGTTTTGCT ACTGCTACTG CTAGTAAATA AACGTGGTTG CCGCTAGCTA
GGCAGCCATG ATCATTGTGT GCATGTTTCA GTTCACTGTC ACGTATGTAT GGGGCTATAT GAATGAAGTT CTGCTATGCT
TGCTATCTCT TC

Locus: Os06g0705400

Loading...

Locus: Os06g0705400

Loading...