Os06t0705400-02

Locus

Os06g0705400

Description

Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.6, OsLtpII.6

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.6, lipid transfer protein 2.6, type 2 non-specific lipid transfer protein 6

Transcript Evidence

AK062667 (DDBJ, Best hit)

Protein Evidence

NP_001149680.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

001-105-F12 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0705400-02)

RiceXPro (AK062667)

Others

Oryzabase (13534)

KEGG (Os06t0705400-02)

Transcript

626 bp

>Os06t0705400-02 Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2).
ACACGCACACTGACACACAGTCACACACCATCCCGCTCTCTCCATCGATCTCCATCACAA
GCTAGCAAAACCAAGAGCCAAGTCGAGCAACACATCATACAATGGCGGGCATCAACCGCA
AGGGCGGCGCGGCGGCGGCGTACGCGGTGGCGCTGTTGCTTGCGGCGGGCGCGGCGGATG
CGGCGGGGTGCAACCCGTCGGCGCTGTCGCCGTGCATGAGCGCGATCATGCTGGGCGCGG
CGCCGTCGCCCGGCTGCTGCGTGCAGCTGCGGGCGCAGCAGCCGTGCCTGTGCCAGTACG
CGCGCGACCCATCCTACCGCAGCTACGTCACGAGCCCCAGCGCGCAGCGCGCCGTCAAGG
CGTGCAACGTCAAGGCCAACTGCTAAATTAAACTGCTGCTACTACTCTACTAGTACTAAT
GCTTGTGCAGTTTTGCTACTGCTACTGCTAGTAAATAAACGTGGTTGCCGCTAGCTAGGC
AGCCATGATCATTGTGTGCATGTTTCAGTTCACTGTCACGTATGTATGGGGCTATATGAA
TGAAGTTCTGCTATGCTTGCTATCTCTTCAATGGGAATCTTGTTGTTATGTTGCTTTGTG
TTACACATAAAAGAAAAGAGTTCAGC

CDS

285 bp

>Os06t0705400-02 Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2).
ATGGCGGGCATCAACCGCAAGGGCGGCGCGGCGGCGGCGTACGCGGTGGCGCTGTTGCTT
GCGGCGGGCGCGGCGGATGCGGCGGGGTGCAACCCGTCGGCGCTGTCGCCGTGCATGAGC
GCGATCATGCTGGGCGCGGCGCCGTCGCCCGGCTGCTGCGTGCAGCTGCGGGCGCAGCAG
CCGTGCCTGTGCCAGTACGCGCGCGACCCATCCTACCGCAGCTACGTCACGAGCCCCAGC
GCGCAGCGCGCCGTCAAGGCGTGCAACGTCAAGGCCAACTGCTAA

Protein

95 aa

>Os06t0705400-02 Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2).
MAGINRKGGAAAAYAVALLLAAGAADAAGCNPSALSPCMSAIMLGAAPSPGCCVQLRAQQ
PCLCQYARDPSYRSYVTSPSAQRAVKACNVKANC*

5'UTR

chr06:29807824..29807924 (+ strand) : 101 bp

CDS

chr06:29807925..29808209 (+ strand) : 285 bp

3'UTR

chr06:29808210..29808449 (+ strand) : 240 bp

FASTA

>Os06t0705400-02 class=Sequence position=chr06:29807824..29808449 (+ strand)
ACACGCACAC TGACACACAG TCACACACCA TCCCGCTCTC TCCATCGATC TCCATCACAA GCTAGCAAAA CCAAGAGCCA
AGTCGAGCAA CACATCATAC AATGGCGGGC ATCAACCGCA AGGGCGGCGC GGCGGCGGCG TACGCGGTGG CGCTGTTGCT
TGCGGCGGGC GCGGCGGATG CGGCGGGGTG CAACCCGTCG GCGCTGTCGC CGTGCATGAG CGCGATCATG CTGGGCGCGG
CGCCGTCGCC CGGCTGCTGC GTGCAGCTGC GGGCGCAGCA GCCGTGCCTG TGCCAGTACG CGCGCGACCC ATCCTACCGC
AGCTACGTCA CGAGCCCCAG CGCGCAGCGC GCCGTCAAGG CGTGCAACGT CAAGGCCAAC TGCTAAATTA AACTGCTGCT
ACTACTCTAC TAGTACTAAT GCTTGTGCAG TTTTGCTACT GCTACTGCTA GTAAATAAAC GTGGTTGCCG CTAGCTAGGC
AGCCATGATC ATTGTGTGCA TGTTTCAGTT CACTGTCACG TATGTATGGG GCTATATGAA TGAAGTTCTG CTATGCTTGC
TATCTCTTCA ATGGGAATCT TGTTGTTATG TTGCTTTGTG TTACACATAA AAGAAAAGAG TTCAGC

Locus: Os06g0705400

Loading...

Locus: Os06g0705400

Loading...