Os06t0708000-01

Locus

Os06g0708000

Description

Mitogen-activated protein kinase

RAP-DB Gene Symbol Synonym(s)

BWMK1, OsBWMK1, MPK12, MAPK1, OsMAPK1, OsMPK12, OsMPK17-1, OsBWMK1L

RAP-DB Gene Name Synonym(s)

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1, blast- and wound- inducible MAPK gene-1, Blast- and wound-induced MAP kinase 1, Mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase 1, MAP kinase 17

CGSNL Gene Symbol

BWMK1

CGSNL Gene Name

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1

Oryzabase Gene Symbol Synonym(s)

OsBWMK1, MPK12, MAPK1, OsMAPK1, OsMPK12, OsMPK17-1, MPK17-1, OsBWMK1L, OsBWMK1M, OsBWMK1S, OsMAPK17-1, MAPK17-1, MAPK12, OsMAPK12

Oryzabase Gene Name Synonym(s)

blast- and wound- inducible MAPK gene-1, Blast- and wound-induced MAP kinase 1, Mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase 1, MAP kinase 17

Transcript Evidence

AK066531

Protein Evidence

Q5Z9J0

Literature

PMID: 12913152

PMID: 10624015

PMID: 17586462

Note

Manual Curation

October 10, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Full-length cDNA

J013074K13 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0708000-01)

RiceXPro (AK066531)

Others

Oryzabase (6000)

KEGG (Os06t0708000-01)

Transcript

2451 bp

>Os06t0708000-01 Mitogen-activated protein kinase
ATCACCACCACCACCACCATCGCTTTCTTCCTCCTCGCCTTCTGCTTCTGCATCCATCCA
TCCATCCATTACTCGCCGAAGACTTCGCGCGGGGAGAGAGGAGGCAAGCTTGGTCGCGGG
AACGCGGGAAGAAAGGTCCGAGCTTGGAAGGAGAAGAAGAAGTAGCCAAGAACGCGAGAG
CTTGGAAGGCGAGCTGCGGTGGTGTAGCTAGCCAATGCCGGCGGGGAACTGGTAGGGAGG
GGGATGGGGGGAGGGGGCACGCTCGTCGACGGATTCCGCCGCCTCTTCCACCGCCGCACG
GCGTCCGGCTCCAACCAGTCGTCCAACGCCGGCGAGGAGGCCGCCTCCTCCGACCTCGAG
GTCGCCGACGACCCGGATCTCGTCGCCCTCCGCTCCATCCGCATCCGCGTGCCCAAGCGC
AAGATGCCTCTCCCCGTCGAGAGCCACAAGAAGAACACAGTGGAAATGGAGTTCTTCACT
GAGTATGGAGAAGCAAGCCAGTACCAGATCCAGGAAGTCATTGGCAAAGGAAGTTATGGA
GTAGTTGCTGCTGCAGTAGATACCCGCACGGGTGAGCGGGTTGCAATCAAGAAGATCAAT
GATGTGTTTGAGCATGTATCAGACGCTACGCGCATATTGCGTGAGATCAAGCTCCTTCGT
CTGCTCCGTCACCCAGACATAGTTGAGATCAAACACATTATGCTTCCCCCTTCTCGAAGG
GAGTTCCAAGATATTTATGTTGTTTTTGAGCTCATGGAATCAGATCTCCATCAAGTCATC
AGAGCGAACGATGACCTCACCCCGGAGCACTACCAGTTTTTCCTGTACCAACTTCTCCGT
GCTCTCAAGTACATCCATGCAGCTAATGTATTTCATCGCGATCTAAAGCCCAAGAATATA
CTGGCAAACTCAGACTGCAAATTGAAAATATGTGATTTCGGACTTGCCCGAGCATCATTC
AATGATGCCCCTTCAGCAATATTTTGGACGGATTATGTTGCAACGAGGTGGTACCGAGCA
CCTGAATTATGTGGCTCATTTTTCTCCAAATACACTCCTGCAATTGATATTTGGAGTATT
GGGTGCATATTTGCTGAACTTCTCACTGGGAGACCACTATTTCCTGGGAAGAATGTTGTG
CACCAATTAGATATTATAACAGATCTTCTTGGAACTCCATCATCAGAAACCTTATCCAGG
ATTCGAAATGAGAAGGCCAGGAGATACTTGAGCACCATGCGGAAAAAACATGCTGTCCCC
TTCTCTCAGAAGTTCCGCAATACTGACCCCTTGGCTCTTCGTCTGCTAGAGCGTTTACTG
GCATTTGATCCTAAAGATCGGTCTTCAGCTGAAGAAGCTTTGGCTGATCCGTACTTCGCA
AGTCTTGCTAATGTGGAACGTGAGCCCTCAAGACATCCAATCTCAAAACTTGAGTTTGAA
TTCGAGAGACGGAAGCTGACAAAAGATGATGTTAGAGAATTAATTTATCGAGAGATTTTG
GAGTATCACCCACAGATGCTGCAAGAGTATATGAAAGGTGGAGAGCAGATTAGCTTCCTC
TATCCAAGTGGGGTTGATCGCTTCAAACGACAGTTTGCACACCTTGAGGAGAACTACAGC
AAAGGAGAAAGAGGTTCTCCACTGCAGAGGAAGCATGCTTCTTTACCGAGGGAGAGAGTA
GGTGTATCAAAGGATGGTTATAACCAACAAAACACCAATGACCAAGAGAGGAGTGCAGAT
TCCGTTGCCCGCACTACAGTAAGCCCTCCAATGTCACAAGATGCACAACAACATGGATCT
GCTGGCCAAAATGGTGTGACATCCACAGACTTGAGTTCGAGGAGCTATCTGAAGAGTGCA
AGCATTAGTGCTTCCAAGTGTGTCGCTGTCAAGGACAATAAAGAACCAGAGGATGATTAC
ATCTCTGAAGAAATGGAAGGGTCGGTCGATGGATTGTCTGAACAAGTCTCCAGGATGCAC
TCCTAGTGCACAACGATGACGATGATCAGTGCAAGATTCTGTGAGGCGCACCAGATGCTG
ATAATTTCCAAGCAGAATGCTGCACTGCAAGTTTGGACTTTGGACAATGCAAGTATGCAA
CAGCCAGCCCGAGATGATTGGCATCTTCTTATGCTCATCCATGTTCACATATTCTTCTTG
CCATTGTGCTGTCTGTCACTACAGGACCCCTGCATGGATTAATGTATTATCCCTCTGATG
TAACACTAGATTAGTCCATCTGTCCATGGAGGAATGAATAGCAAGCAGCCAGCTTGTGCA
TCATGTGGGCATGTTCATTTTCCAGTGAGATCTAGTCATATCCATGCTTTTTTTGTAATG
GTATATGAAACAGTTTATCAGTGAGACTCTGGTCCATTCCTCTTTGAAGAACTGCTGAGA
CAGTGATCCATTCCTCTTTGAAGAACTGTTCATTTTCAGTACATTAAGCCT

CDS

1743 bp

>Os06t0708000-01 Mitogen-activated protein kinase
ATGGGGGGAGGGGGCACGCTCGTCGACGGATTCCGCCGCCTCTTCCACCGCCGCACGGCG
TCCGGCTCCAACCAGTCGTCCAACGCCGGCGAGGAGGCCGCCTCCTCCGACCTCGAGGTC
GCCGACGACCCGGATCTCGTCGCCCTCCGCTCCATCCGCATCCGCGTGCCCAAGCGCAAG
ATGCCTCTCCCCGTCGAGAGCCACAAGAAGAACACAGTGGAAATGGAGTTCTTCACTGAG
TATGGAGAAGCAAGCCAGTACCAGATCCAGGAAGTCATTGGCAAAGGAAGTTATGGAGTA
GTTGCTGCTGCAGTAGATACCCGCACGGGTGAGCGGGTTGCAATCAAGAAGATCAATGAT
GTGTTTGAGCATGTATCAGACGCTACGCGCATATTGCGTGAGATCAAGCTCCTTCGTCTG
CTCCGTCACCCAGACATAGTTGAGATCAAACACATTATGCTTCCCCCTTCTCGAAGGGAG
TTCCAAGATATTTATGTTGTTTTTGAGCTCATGGAATCAGATCTCCATCAAGTCATCAGA
GCGAACGATGACCTCACCCCGGAGCACTACCAGTTTTTCCTGTACCAACTTCTCCGTGCT
CTCAAGTACATCCATGCAGCTAATGTATTTCATCGCGATCTAAAGCCCAAGAATATACTG
GCAAACTCAGACTGCAAATTGAAAATATGTGATTTCGGACTTGCCCGAGCATCATTCAAT
GATGCCCCTTCAGCAATATTTTGGACGGATTATGTTGCAACGAGGTGGTACCGAGCACCT
GAATTATGTGGCTCATTTTTCTCCAAATACACTCCTGCAATTGATATTTGGAGTATTGGG
TGCATATTTGCTGAACTTCTCACTGGGAGACCACTATTTCCTGGGAAGAATGTTGTGCAC
CAATTAGATATTATAACAGATCTTCTTGGAACTCCATCATCAGAAACCTTATCCAGGATT
CGAAATGAGAAGGCCAGGAGATACTTGAGCACCATGCGGAAAAAACATGCTGTCCCCTTC
TCTCAGAAGTTCCGCAATACTGACCCCTTGGCTCTTCGTCTGCTAGAGCGTTTACTGGCA
TTTGATCCTAAAGATCGGTCTTCAGCTGAAGAAGCTTTGGCTGATCCGTACTTCGCAAGT
CTTGCTAATGTGGAACGTGAGCCCTCAAGACATCCAATCTCAAAACTTGAGTTTGAATTC
GAGAGACGGAAGCTGACAAAAGATGATGTTAGAGAATTAATTTATCGAGAGATTTTGGAG
TATCACCCACAGATGCTGCAAGAGTATATGAAAGGTGGAGAGCAGATTAGCTTCCTCTAT
CCAAGTGGGGTTGATCGCTTCAAACGACAGTTTGCACACCTTGAGGAGAACTACAGCAAA
GGAGAAAGAGGTTCTCCACTGCAGAGGAAGCATGCTTCTTTACCGAGGGAGAGAGTAGGT
GTATCAAAGGATGGTTATAACCAACAAAACACCAATGACCAAGAGAGGAGTGCAGATTCC
GTTGCCCGCACTACAGTAAGCCCTCCAATGTCACAAGATGCACAACAACATGGATCTGCT
GGCCAAAATGGTGTGACATCCACAGACTTGAGTTCGAGGAGCTATCTGAAGAGTGCAAGC
ATTAGTGCTTCCAAGTGTGTCGCTGTCAAGGACAATAAAGAACCAGAGGATGATTACATC
TCTGAAGAAATGGAAGGGTCGGTCGATGGATTGTCTGAACAAGTCTCCAGGATGCACTCC
TAG

Protein

580 aa

>Os06t0708000-01 Mitogen-activated protein kinase
MGGGGTLVDGFRRLFHRRTASGSNQSSNAGEEAASSDLEVADDPDLVALRSIRIRVPKRK
MPLPVESHKKNTVEMEFFTEYGEASQYQIQEVIGKGSYGVVAAAVDTRTGERVAIKKIND
VFEHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFELMESDLHQVIR
ANDDLTPEHYQFFLYQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLARASFN
DAPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVH
QLDIITDLLGTPSSETLSRIRNEKARRYLSTMRKKHAVPFSQKFRNTDPLALRLLERLLA
FDPKDRSSAEEALADPYFASLANVEREPSRHPISKLEFEFERRKLTKDDVRELIYREILE
YHPQMLQEYMKGGEQISFLYPSGVDRFKRQFAHLEENYSKGERGSPLQRKHASLPRERVG
VSKDGYNQQNTNDQERSADSVARTTVSPPMSQDAQQHGSAGQNGVTSTDLSSRSYLKSAS
ISASKCVAVKDNKEPEDDYISEEMEGSVDGLSEQVSRMHS*

5'UTR

chr06:29949898..29950140 (+ strand) : 243 bp

CDS

chr06:29950141..29950350 (+ strand) : 210 bp

chr06:29951252..29951660 (+ strand) : 409 bp

chr06:29951794..29951921 (+ strand) : 128 bp

chr06:29951995..29952054 (+ strand) : 60 bp

chr06:29952402..29952551 (+ strand) : 150 bp

chr06:29952672..29952827 (+ strand) : 156 bp

chr06:29952946..29953083 (+ strand) : 138 bp

chr06:29953171..29953244 (+ strand) : 74 bp

chr06:29953653..29953754 (+ strand) : 102 bp

chr06:29953852..29954092 (+ strand) : 241 bp

chr06:29954279..29954353 (+ strand) : 75 bp

3'UTR

chr06:29954354..29954818 (+ strand) : 465 bp

FASTA

>Os06t0708000-01 class=Sequence position=chr06:29949898..29954818 (+ strand)
ATCACCACCA CCACCACCAT CGCTTTCTTC CTCCTCGCCT TCTGCTTCTG CATCCATCCA TCCATCCATT ACTCGCCGAA
GACTTCGCGC GGGGAGAGAG GAGGCAAGCT TGGTCGCGGG AACGCGGGAA GAAAGGTCCG AGCTTGGAAG GAGAAGAAGA
AGTAGCCAAG AACGCGAGAG CTTGGAAGGC GAGCTGCGGT GGTGTAGCTA GCCAATGCCG GCGGGGAACT GGTAGGGAGG
GGGATGGGGG GAGGGGGCAC GCTCGTCGAC GGATTCCGCC GCCTCTTCCA CCGCCGCACG GCGTCCGGCT CCAACCAGTC
GTCCAACGCC GGCGAGGAGG CCGCCTCCTC CGACCTCGAG GTCGCCGACG ACCCGGATCT CGTCGCCCTC CGCTCCATCC
GCATCCGCGT GCCCAAGCGC AAGATGCCTC TCCCCGTCGA GAGCCACAAG AAGGTGAGGA GGTGCCTAGT GTGAAGTGTG
CTTTGCTTTG CTTCGTTTTC TTTTCAGTTT GGGGGTGAAA TGAAAGTTTC AGGCTTTCTC GTGATCCTTG ATTCGTGGCC
ACGAGGGGTT CTTAGACTAG ATCAGATCTT CGTGGCACCT GAATTACTTG CATACTGTAC AATATCATTA TTTCTTTTTT
TCTATGATCT GTGCAAAGTG CAATACAGCT CAAGTGCAGG TAAAGCTTGC GTGTTCTATC CAATCTTTCT TCTTTCGATG
GTTGCTTGTA GAGCGATAGT TGCTTGTAAA CTGCCATCCG ATTCGTCATC CTGGCTGTTG ACCTGTGTTA TTCCAGTGAT
CTATGAAACG ATCGATCTCG TAAAACTTAA GTTTCTTTCT TTCTTTCTCT GTTTGCTTAG TTCTGAAATT ACTTGCTCCT
GCATGCTCCA TTTCTTAGAG GAGTGCAATT GCAGCACTAC TATGCAAAAA GCTTGTGCCC TCTTTTGGAG CTGTTCTCAA
CAATTGGTCC CATCATCCTT GTCATACTGA TCCTTAGGAG CTCATATCCA AGTTGTCCAC TTGTGGTTTT GGATGATCTC
ATCAGAATCG GCTACTAATT AGTACTCCAG GTTTGACTTG GTCTGGCCTA TGTATATCTC TGGTACGGAC TGTTTCTATT
GGGAACAAGT CGCGTCTTGC ACATGGTATG GAGCAGGTGT TCCTTTCATT TGCGAATAAA CCTACATGTC TATGTACTGA
AAATGTCAAT TTTTGTTAGG TTGGTCATGA TATTCCCAGG GACAAGATCA TGGTTTTGTT TATAGGGCTA TTCTACTACT
GAAGAAGTTT TATAACCAGC CACTCTGTAT TTTTAGTTAG CTTAATATTT TCTTGCAAAA TTGTGATCTT GTAGAACACA
GTGGAAATGG AGTTCTTCAC TGAGTATGGA GAAGCAAGCC AGTACCAGAT CCAGGAAGTC ATTGGCAAAG GAAGTTATGG
AGTAGTTGCT GCTGCAGTAG ATACCCGCAC GGGTGAGCGG GTTGCAATCA AGAAGATCAA TGATGTGTTT GAGCATGTAT
CAGACGCTAC GCGCATATTG CGTGAGATCA AGCTCCTTCG TCTGCTCCGT CACCCAGACA TAGTTGAGAT CAAACACATT
ATGCTTCCCC CTTCTCGAAG GGAGTTCCAA GATATTTATG TTGTTTTTGA GCTCATGGAA TCAGATCTCC ATCAAGTCAT
CAGAGCGAAC GATGACCTCA CCCCGGAGCA CTACCAGTTT TTCCTGTACC AACTTCTCCG TGCTCTCAAG TACATCCATG
CAGGTAAGCT TAACTACTGA TAATCCCCAA TTCCCCAAGA ACCTACTTGA CCACCATTAA ACACATAGTT CTGTTGATTT
ATCAATTAAC ATGGAATTCT AGCTTATTCT CTGATAAATC ATCTATATTG GCACAGCTAA TGTATTTCAT CGCGATCTAA
AGCCCAAGAA TATACTGGCA AACTCAGACT GCAAATTGAA AATATGTGAT TTCGGACTTG CCCGAGCATC ATTCAATGAT
GCCCCTTCAG CAATATTTTG GACGGTAAGG TGCTTATATG AGATTTTACA TTCCTCTTTA AGTCTTTATG TTATTAATTA
TGTTCTACTT TGTGAAGGAT TATGTTGCAA CGAGGTGGTA CCGAGCACCT GAATTATGTG GCTCATTTTT CTCCAAAGTA
AGGTCTTCAA CACTAGAATT CTTTCAATCA AGATTAATGC TTTTGTGGCA CCATAGATGA ACTGGTCTAG TTGTTTTTAG
CAATGCTTTC TTTTTTTTTT CCTTTTTCTT TATCTATCCA ACTTACAGTT GTGCTAAATG AAGTATAGAA AATTAAGTTA
TTTTTCTTTT TGTTGATATT TTAGTTGTTT GTACATACAA TTTTCTATCA AAGCTGCGCC ACTTGAAACT GGATGAGTAA
CATTCTTGTA GAGAAACAAT ATACTGTGAA CTCTTTTGTG CAATGCTGAT GCTCTAGCGT TCCATGTGTT TTATGTGTTC
TAACAATAGC CAATTTGCAT ACAGTACACT CCTGCAATTG ATATTTGGAG TATTGGGTGC ATATTTGCTG AACTTCTCAC
TGGGAGACCA CTATTTCCTG GGAAGAATGT TGTGCACCAA TTAGATATTA TAACAGATCT TCTTGGAACT CCATCATCAG
AAACCTTATC CAGGGTATGT TTACTTTATA CCGATTCTCA TATATCCTTG AACCTCCTAT TCAGTAACAT TCAAGAAGAT
CCAATTCTCT AATAAGATGA AACAATCACC TTACTGTTTT CTGCGTCTCT GCAGATTCGA AATGAGAAGG CCAGGAGATA
CTTGAGCACC ATGCGGAAAA AACATGCTGT CCCCTTCTCT CAGAAGTTCC GCAATACTGA CCCCTTGGCT CTTCGTCTGC
TAGAGCGTTT ACTGGCATTT GATCCTAAAG ATCGGTCTTC AGCTGAAGAA GTAAGCTCAA GAGAAAGCAT AGCATCCTTT
CCAAACCTCA AAAGTAGTTT TTTTTTAAAA AAAAAAACTT TCAGAAAACA CACATTTTTT ATATGTTATA TTCTCTTCCA
ATTTTCAGGC TTTGGCTGAT CCGTACTTCG CAAGTCTTGC TAATGTGGAA CGTGAGCCCT CAAGACATCC AATCTCAAAA
CTTGAGTTTG AATTCGAGAG ACGGAAGCTG ACAAAAGATG ATGTTAGAGA ATTAATTTAT CGAGAGGTAC AAAGCAATAG
CTCAAGTTTC CTGCTTTGTG TTAATAATAA AATTTTCAGC TTTTCAAGAT TGATAATTAT GAAATGCAAA CAGATTTTGG
AGTATCACCC ACAGATGCTG CAAGAGTATA TGAAAGGTGG AGAGCAGATT AGCTTCCTCT ATCCAAGGTG GAGTCTTGCA
TTAATTTTTC TTTCTTTCAT CAGTTTTAAA TTTGACGTGA CAAAGATGAA TATCTGGCTT TGTTCCAGCA AGTTAGCATG
GTGTACAATA TACTTCTTTG CACCAACAAA ATTGCCTTCG CCAAATACTC TTGTTGGCAA AGCAAATTTA CTAAGTATAG
TAGTAATTTG CTTTGCAGTG CTATCATGAG TTAATATCTG ATCTATTCTT GTTGCTCTCA TTTTGGTATA TCTTTATTTC
CAAGGCTCCT TTCACCCGAA AATTGCATGG ACATTGTTAC AGGAAACACT AGCCATGTGT GCATCTAATA TATATTTATC
ATGTCCTTGC ATGGTTTTCT CTCCTTTTTT TACCGTGAAC ATAGCTATTC TGTTAATATT GTTATCTTAC TGCAGTGGGG
TTGATCGCTT CAAACGACAG TTTGCACACC TTGAGGAGAA CTACAGCAAA GGAGAAAGAG GTTCTCCACT GCAGAGGAAG
CATGCTTCTT TACCGAGGTA CATAATGTGG CAATATCAGA AATCAAAAGT GCAGACCTAC TTACTTTCAT ATCAATTATT
GTACTAACTT CTCCATTGAT TTTGCATATA ACAGGGAGAG AGTAGGTGTA TCAAAGGATG GTTATAACCA ACAAAACACC
AATGACCAAG AGAGGAGTGC AGATTCCGTT GCCCGCACTA CAGTAAGCCC TCCAATGTCA CAAGATGCAC AACAACATGG
ATCTGCTGGC CAAAATGGTG TGACATCCAC AGACTTGAGT TCGAGGAGCT ATCTGAAGAG TGCAAGCATT AGTGCTTCCA
AGTGTGTCGC TGTCAAGGAC AATAAAGAAC CAGAGGTACT GTTACTTTGC TGCCTGAAAT TTGTCTATGA TTCTTATAAG
TCGGCAAAGT TGCATAGCTA TGCACGATCG AACAAAAGTA TAAGAAATGA TGCGTGAAAA GAAAAGGAAT TGACTGGTTT
GTTGCATAGG TAGTAACTCC ATTTCCCTTT GCATTTCCCT TTTGTTTTTG CTATCCTTTA GGATGATTAC ATCTCTGAAG
AAATGGAAGG GTCGGTCGAT GGATTGTCTG AACAAGTCTC CAGGATGCAC TCCTAGTGCA CAACGATGAC GATGATCAGT
GCAAGATTCT GTGAGGCGCA CCAGATGCTG ATAATTTCCA AGCAGAATGC TGCACTGCAA GTTTGGACTT TGGACAATGC
AAGTATGCAA CAGCCAGCCC GAGATGATTG GCATCTTCTT ATGCTCATCC ATGTTCACAT ATTCTTCTTG CCATTGTGCT
GTCTGTCACT ACAGGACCCC TGCATGGATT AATGTATTAT CCCTCTGATG TAACACTAGA TTAGTCCATC TGTCCATGGA
GGAATGAATA GCAAGCAGCC AGCTTGTGCA TCATGTGGGC ATGTTCATTT TCCAGTGAGA TCTAGTCATA TCCATGCTTT
TTTTGTAATG GTATATGAAA CAGTTTATCA GTGAGACTCT GGTCCATTCC TCTTTGAAGA ACTGCTGAGA CAGTGATCCA
TTCCTCTTTG AAGAACTGTT CATTTTCAGT ACATTAAGCC T

Locus: Os06g0708000

Loading...

Locus: Os06g0708000

Loading...