Os06t0708000-02

Locus

Os06g0708000

Description

Mitogen-activated protein kinase, Defense response

RAP-DB Gene Symbol Synonym(s)

BWMK1, OsBWMK1S

RAP-DB Gene Name Synonym(s)

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1

CGSNL Gene Symbol

BWMK1

CGSNL Gene Name

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1

Oryzabase Gene Symbol Synonym(s)

OsBWMK1, MPK12, MAPK1, OsMAPK1, OsMPK12, OsMPK17-1, MPK17-1, OsBWMK1L, OsBWMK1M, OsBWMK1S, OsMAPK17-1, MAPK17-1, MAPK12, OsMAPK12

Oryzabase Gene Name Synonym(s)

blast- and wound- inducible MAPK gene-1, Blast- and wound-induced MAP kinase 1, Mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase 1, MAP kinase 17

Transcript Evidence

AK067925

AF177392

Protein Evidence

Q5Z9J0-2

Literature

PMID: 17586462

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 10, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Full-length cDNA

J013121F14 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0708000-02)

RiceXPro (AK067925)

Others

Oryzabase (6000)

KEGG (Os06t0708000-02)

Transcript

2736 bp

>Os06t0708000-02 Mitogen-activated protein kinase, Defense response
AAGTGCAGGTAAAGCTTGCGTGTTCTATCCAATCTTTCTTCTTTCGATGGTTGCTTGTAG
AGCGATAGTTGCTTGTAAACTGCCATCCGATTCGTCATCCTGGCTGTTGACCTGTGTTAT
TCCAGTGATCTATGAAACGATCGATCTCGTAAAACTTAAGTTTCTTTCTTTCTTTCTCTG
TTTGCTTAGTTCTGAAATTACTTGCTCCTGCATGCTCCATTTCTTAGAGGAGTGCAATTG
CAGCACTACTATGCAAAAAGCTTGTGCCCTCTTTTGGAGCTGTTCTCAACAATTGGTCCC
ATCATCCTTGTCATACTGATCCTTAGGAGCTCATATCCAAGTTGTCCACTTGTGGTTTTG
GATGATCTCATCAGAATCGGCTACTAATTAGTACTCCAGGTTTGACTTGGTCTGGCCTAT
GTATATCTCTGGTACGGACTGTTTCTATTGGGAACAAGTCGCGTCTTGCACATGGTATGG
AGCAGGTGTTCCTTTCATTTGCGAATAAACCTACATGTCTATGTACTGAAAATGTCAATT
TTTGTTAGGTTGGTCATGATATTCCCAGGGACAAGATCATGGTTTTGTTTATAGGGCTAT
TCTACTACTGAAGAAGTTTTATAACCAGCCACTCTGTATTTTTAGTTAGCTTAATATTTT
CTTGCAAAATTGTGATCTTGTAGAACACAGTGGAAATGGAGTTCTTCACTGAGTATGGAG
AAGCAAGCCAGTACCAGATCCAGGAAGTCATTGGCAAAGGAAGTTATGGAGTAGTTGCTG
CTGCAGTAGATACCCGCACGGGTGAGCGGGTTGCAATCAAGAAGATCAATGATGTGTTTG
AGCATGTATCAGACGCTACGCGCATATTGCGTGAGATCAAGCTCCTTCGTCTGCTCCGTC
ACCCAGACATAGTTGAGATCAAACACATTATGCTTCCCCCTTCTCGAAGGGAGTTCCAAG
ATATTTATGTTGTTTTTGAGCTCATGGAATCAGATCTCCATCAAGTCATCAGAGCGAACG
ATGACCTCACCCCGGAGCACTACCAGTTTTTCCTGTACCAACTTCTCCGTGCTCTCAAGT
ACATCCATGCAGCTAATGTATTTCATCGCGATCTAAAGCCCAAGAATATACTGGCAAACT
CAGACTGCAAATTGAAAATATGTGATTTCGGACTTGCCCGAGCATCATTCAATGATGCCC
CTTCAGCAATATTTTGGACGGATTATGTTGCAACGAGGTGGTACCGAGCACCTGAATTAT
GTGGCTCATTTTTCTCCAAATACACTCCTGCAATTGATATTTGGAGTATTGGGTGCATAT
TTGCTGAACTTCTCACTGGGAGACCACTATTTCCTGGGAAGAATGTTGTGCACCAATTAG
ATATTATAACAGATCTTCTTGGAACTCCATCATCAGAAACCTTATCCAGGATTCGAAATG
AGAAGGCCAGGAGATACTTGAGCACCATGCGGAAAAAACATGCTGTCCCCTTCTCTCAGA
AGTTCCGCAATACTGACCCCTTGGCTCTTCGTCTGCTAGAGCGTTTACTGGCATTTGATC
CTAAAGATCGGTCTTCAGCTGAAGAAGCTTTGGCTGATCCGTACTTCGCAAGTCTTGCTA
ATGTGGAACGTGAGCCCTCAAGACATCCAATCTCAAAACTTGAGTTTGAATTCGAGAGAC
GGAAGCTGACAAAAGATGATGTTAGAGAATTAATTTATCGAGAGATTTTGGAGTATCACC
CACAGATGCTGCAAGAGTATATGAAAGGTGGAGAGCAGATTAGCTTCCTCTATCCAAGTG
GGGTTGATCGCTTCAAACGACAGTTTGCACACCTTGAGGAGAACTACAGCAAAGGAGAAA
GAGGTTCTCCACTGCAGAGGAAGCATGCTTCTTTACCGAGGGAGAGAGTAGGTGTATCAA
AGGATGGTTATAACCAACAAAACACCAATGACCAAGAGAGGAGTGCAGATTCCGTTGCCC
GCACTACAGTAAGCCCTCCAATGTCACAAGATGCACAACAACATGGATCTGCTGGCCAAA
ATGGTGTGACATCCACAGACTTGAGTTCGAGGAGCTATCTGAAGAGTGCAAGCATTAGTG
CTTCCAAGTGTGTCGCTGTCAAGGACAATAAAGAACCAGAGGATGATTACATCTCTGAAG
AAATGGAAGGGTCGGTCGATGGATTGTCTGAACAAGTCTCCAGGATGCACTCCTAGTGCA
CAACGATGACGATGATCAGTGCAAGATTCTGTGAGGCGCACCAGATGCTGATAATTTCCA
AGCAGAATGCTGCACTGCAAGTTTGGACTTTGGACAATGCAAGTATGCAACAGCCAGCCC
GAGATGATTGGCATCTTCTTATGCTCATCCATGTTCACATATTCTTCTTGCCATTGTGCT
GTCTGTCACTACAGGACCCCTGCATGGATTAATGTATTATCCCTCTGATGTAACACTAGA
TTAGTCCATCTGTCCATGGAGGAATGAATAGCAAGCAGCCAGCTTGTGCATCATGTGGGC
ATGTTCATTTTCCAGTGAGATCTAGTCATATCCATGCTTTTTTTGTAATGGTATATGAAA
CAGTTTATCAGTGAGACTCTGGTCCATTCCTCTTTGAAGAACTGCTGAGACAGTGATCCA
TTCCTCTTTGAAGAACTGTTCATTTTCAGTACATTAAGCCTAGTAAAGTTCAGATGTTTG
AGTTCGGTGCTTAATAATCATGTCACACGAATTTTC

CDS

1521 bp

>Os06t0708000-02 Mitogen-activated protein kinase, Defense response
ATGGAGTTCTTCACTGAGTATGGAGAAGCAAGCCAGTACCAGATCCAGGAAGTCATTGGC
AAAGGAAGTTATGGAGTAGTTGCTGCTGCAGTAGATACCCGCACGGGTGAGCGGGTTGCA
ATCAAGAAGATCAATGATGTGTTTGAGCATGTATCAGACGCTACGCGCATATTGCGTGAG
ATCAAGCTCCTTCGTCTGCTCCGTCACCCAGACATAGTTGAGATCAAACACATTATGCTT
CCCCCTTCTCGAAGGGAGTTCCAAGATATTTATGTTGTTTTTGAGCTCATGGAATCAGAT
CTCCATCAAGTCATCAGAGCGAACGATGACCTCACCCCGGAGCACTACCAGTTTTTCCTG
TACCAACTTCTCCGTGCTCTCAAGTACATCCATGCAGCTAATGTATTTCATCGCGATCTA
AAGCCCAAGAATATACTGGCAAACTCAGACTGCAAATTGAAAATATGTGATTTCGGACTT
GCCCGAGCATCATTCAATGATGCCCCTTCAGCAATATTTTGGACGGATTATGTTGCAACG
AGGTGGTACCGAGCACCTGAATTATGTGGCTCATTTTTCTCCAAATACACTCCTGCAATT
GATATTTGGAGTATTGGGTGCATATTTGCTGAACTTCTCACTGGGAGACCACTATTTCCT
GGGAAGAATGTTGTGCACCAATTAGATATTATAACAGATCTTCTTGGAACTCCATCATCA
GAAACCTTATCCAGGATTCGAAATGAGAAGGCCAGGAGATACTTGAGCACCATGCGGAAA
AAACATGCTGTCCCCTTCTCTCAGAAGTTCCGCAATACTGACCCCTTGGCTCTTCGTCTG
CTAGAGCGTTTACTGGCATTTGATCCTAAAGATCGGTCTTCAGCTGAAGAAGCTTTGGCT
GATCCGTACTTCGCAAGTCTTGCTAATGTGGAACGTGAGCCCTCAAGACATCCAATCTCA
AAACTTGAGTTTGAATTCGAGAGACGGAAGCTGACAAAAGATGATGTTAGAGAATTAATT
TATCGAGAGATTTTGGAGTATCACCCACAGATGCTGCAAGAGTATATGAAAGGTGGAGAG
CAGATTAGCTTCCTCTATCCAAGTGGGGTTGATCGCTTCAAACGACAGTTTGCACACCTT
GAGGAGAACTACAGCAAAGGAGAAAGAGGTTCTCCACTGCAGAGGAAGCATGCTTCTTTA
CCGAGGGAGAGAGTAGGTGTATCAAAGGATGGTTATAACCAACAAAACACCAATGACCAA
GAGAGGAGTGCAGATTCCGTTGCCCGCACTACAGTAAGCCCTCCAATGTCACAAGATGCA
CAACAACATGGATCTGCTGGCCAAAATGGTGTGACATCCACAGACTTGAGTTCGAGGAGC
TATCTGAAGAGTGCAAGCATTAGTGCTTCCAAGTGTGTCGCTGTCAAGGACAATAAAGAA
CCAGAGGATGATTACATCTCTGAAGAAATGGAAGGGTCGGTCGATGGATTGTCTGAACAA
GTCTCCAGGATGCACTCCTAG

Protein

506 aa

>Os06t0708000-02 Mitogen-activated protein kinase, Defense response
MEFFTEYGEASQYQIQEVIGKGSYGVVAAAVDTRTGERVAIKKINDVFEHVSDATRILRE
IKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFELMESDLHQVIRANDDLTPEHYQFFL
YQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLARASFNDAPSAIFWTDYVAT
RWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVHQLDIITDLLGTPSS
ETLSRIRNEKARRYLSTMRKKHAVPFSQKFRNTDPLALRLLERLLAFDPKDRSSAEEALA
DPYFASLANVEREPSRHPISKLEFEFERRKLTKDDVRELIYREILEYHPQMLQEYMKGGE
QISFLYPSGVDRFKRQFAHLEENYSKGERGSPLQRKHASLPRERVGVSKDGYNQQNTNDQ
ERSADSVARTTVSPPMSQDAQQHGSAGQNGVTSTDLSSRSYLKSASISASKCVAVKDNKE
PEDDYISEEMEGSVDGLSEQVSRMHS*

5'UTR

chr06:29950569..29951263 (+ strand) : 695 bp

CDS

chr06:29951264..29951660 (+ strand) : 397 bp

chr06:29951794..29951921 (+ strand) : 128 bp

chr06:29951995..29952054 (+ strand) : 60 bp

chr06:29952402..29952551 (+ strand) : 150 bp

chr06:29952672..29952827 (+ strand) : 156 bp

chr06:29952946..29953083 (+ strand) : 138 bp

chr06:29953171..29953244 (+ strand) : 74 bp

chr06:29953653..29953754 (+ strand) : 102 bp

chr06:29953852..29954092 (+ strand) : 241 bp

chr06:29954279..29954353 (+ strand) : 75 bp

3'UTR

chr06:29954354..29954873 (+ strand) : 520 bp

FASTA

>Os06t0708000-02 class=Sequence position=chr06:29950569..29954873 (+ strand)
AAGTGCAGGT AAAGCTTGCG TGTTCTATCC AATCTTTCTT CTTTCGATGG TTGCTTGTAG AGCGATAGTT GCTTGTAAAC
TGCCATCCGA TTCGTCATCC TGGCTGTTGA CCTGTGTTAT TCCAGTGATC TATGAAACGA TCGATCTCGT AAAACTTAAG
TTTCTTTCTT TCTTTCTCTG TTTGCTTAGT TCTGAAATTA CTTGCTCCTG CATGCTCCAT TTCTTAGAGG AGTGCAATTG
CAGCACTACT ATGCAAAAAG CTTGTGCCCT CTTTTGGAGC TGTTCTCAAC AATTGGTCCC ATCATCCTTG TCATACTGAT
CCTTAGGAGC TCATATCCAA GTTGTCCACT TGTGGTTTTG GATGATCTCA TCAGAATCGG CTACTAATTA GTACTCCAGG
TTTGACTTGG TCTGGCCTAT GTATATCTCT GGTACGGACT GTTTCTATTG GGAACAAGTC GCGTCTTGCA CATGGTATGG
AGCAGGTGTT CCTTTCATTT GCGAATAAAC CTACATGTCT ATGTACTGAA AATGTCAATT TTTGTTAGGT TGGTCATGAT
ATTCCCAGGG ACAAGATCAT GGTTTTGTTT ATAGGGCTAT TCTACTACTG AAGAAGTTTT ATAACCAGCC ACTCTGTATT
TTTAGTTAGC TTAATATTTT CTTGCAAAAT TGTGATCTTG TAGAACACAG TGGAAATGGA GTTCTTCACT GAGTATGGAG
AAGCAAGCCA GTACCAGATC CAGGAAGTCA TTGGCAAAGG AAGTTATGGA GTAGTTGCTG CTGCAGTAGA TACCCGCACG
GGTGAGCGGG TTGCAATCAA GAAGATCAAT GATGTGTTTG AGCATGTATC AGACGCTACG CGCATATTGC GTGAGATCAA
GCTCCTTCGT CTGCTCCGTC ACCCAGACAT AGTTGAGATC AAACACATTA TGCTTCCCCC TTCTCGAAGG GAGTTCCAAG
ATATTTATGT TGTTTTTGAG CTCATGGAAT CAGATCTCCA TCAAGTCATC AGAGCGAACG ATGACCTCAC CCCGGAGCAC
TACCAGTTTT TCCTGTACCA ACTTCTCCGT GCTCTCAAGT ACATCCATGC AGGTAAGCTT AACTACTGAT AATCCCCAAT
TCCCCAAGAA CCTACTTGAC CACCATTAAA CACATAGTTC TGTTGATTTA TCAATTAACA TGGAATTCTA GCTTATTCTC
TGATAAATCA TCTATATTGG CACAGCTAAT GTATTTCATC GCGATCTAAA GCCCAAGAAT ATACTGGCAA ACTCAGACTG
CAAATTGAAA ATATGTGATT TCGGACTTGC CCGAGCATCA TTCAATGATG CCCCTTCAGC AATATTTTGG ACGGTAAGGT
GCTTATATGA GATTTTACAT TCCTCTTTAA GTCTTTATGT TATTAATTAT GTTCTACTTT GTGAAGGATT ATGTTGCAAC
GAGGTGGTAC CGAGCACCTG AATTATGTGG CTCATTTTTC TCCAAAGTAA GGTCTTCAAC ACTAGAATTC TTTCAATCAA
GATTAATGCT TTTGTGGCAC CATAGATGAA CTGGTCTAGT TGTTTTTAGC AATGCTTTCT TTTTTTTTTC CTTTTTCTTT
ATCTATCCAA CTTACAGTTG TGCTAAATGA AGTATAGAAA ATTAAGTTAT TTTTCTTTTT GTTGATATTT TAGTTGTTTG
TACATACAAT TTTCTATCAA AGCTGCGCCA CTTGAAACTG GATGAGTAAC ATTCTTGTAG AGAAACAATA TACTGTGAAC
TCTTTTGTGC AATGCTGATG CTCTAGCGTT CCATGTGTTT TATGTGTTCT AACAATAGCC AATTTGCATA CAGTACACTC
CTGCAATTGA TATTTGGAGT ATTGGGTGCA TATTTGCTGA ACTTCTCACT GGGAGACCAC TATTTCCTGG GAAGAATGTT
GTGCACCAAT TAGATATTAT AACAGATCTT CTTGGAACTC CATCATCAGA AACCTTATCC AGGGTATGTT TACTTTATAC
CGATTCTCAT ATATCCTTGA ACCTCCTATT CAGTAACATT CAAGAAGATC CAATTCTCTA ATAAGATGAA ACAATCACCT
TACTGTTTTC TGCGTCTCTG CAGATTCGAA ATGAGAAGGC CAGGAGATAC TTGAGCACCA TGCGGAAAAA ACATGCTGTC
CCCTTCTCTC AGAAGTTCCG CAATACTGAC CCCTTGGCTC TTCGTCTGCT AGAGCGTTTA CTGGCATTTG ATCCTAAAGA
TCGGTCTTCA GCTGAAGAAG TAAGCTCAAG AGAAAGCATA GCATCCTTTC CAAACCTCAA AAGTAGTTTT TTTTTAAAAA
AAAAAACTTT CAGAAAACAC ACATTTTTTA TATGTTATAT TCTCTTCCAA TTTTCAGGCT TTGGCTGATC CGTACTTCGC
AAGTCTTGCT AATGTGGAAC GTGAGCCCTC AAGACATCCA ATCTCAAAAC TTGAGTTTGA ATTCGAGAGA CGGAAGCTGA
CAAAAGATGA TGTTAGAGAA TTAATTTATC GAGAGGTACA AAGCAATAGC TCAAGTTTCC TGCTTTGTGT TAATAATAAA
ATTTTCAGCT TTTCAAGATT GATAATTATG AAATGCAAAC AGATTTTGGA GTATCACCCA CAGATGCTGC AAGAGTATAT
GAAAGGTGGA GAGCAGATTA GCTTCCTCTA TCCAAGGTGG AGTCTTGCAT TAATTTTTCT TTCTTTCATC AGTTTTAAAT
TTGACGTGAC AAAGATGAAT ATCTGGCTTT GTTCCAGCAA GTTAGCATGG TGTACAATAT ACTTCTTTGC ACCAACAAAA
TTGCCTTCGC CAAATACTCT TGTTGGCAAA GCAAATTTAC TAAGTATAGT AGTAATTTGC TTTGCAGTGC TATCATGAGT
TAATATCTGA TCTATTCTTG TTGCTCTCAT TTTGGTATAT CTTTATTTCC AAGGCTCCTT TCACCCGAAA ATTGCATGGA
CATTGTTACA GGAAACACTA GCCATGTGTG CATCTAATAT ATATTTATCA TGTCCTTGCA TGGTTTTCTC TCCTTTTTTT
ACCGTGAACA TAGCTATTCT GTTAATATTG TTATCTTACT GCAGTGGGGT TGATCGCTTC AAACGACAGT TTGCACACCT
TGAGGAGAAC TACAGCAAAG GAGAAAGAGG TTCTCCACTG CAGAGGAAGC ATGCTTCTTT ACCGAGGTAC ATAATGTGGC
AATATCAGAA ATCAAAAGTG CAGACCTACT TACTTTCATA TCAATTATTG TACTAACTTC TCCATTGATT TTGCATATAA
CAGGGAGAGA GTAGGTGTAT CAAAGGATGG TTATAACCAA CAAAACACCA ATGACCAAGA GAGGAGTGCA GATTCCGTTG
CCCGCACTAC AGTAAGCCCT CCAATGTCAC AAGATGCACA ACAACATGGA TCTGCTGGCC AAAATGGTGT GACATCCACA
GACTTGAGTT CGAGGAGCTA TCTGAAGAGT GCAAGCATTA GTGCTTCCAA GTGTGTCGCT GTCAAGGACA ATAAAGAACC
AGAGGTACTG TTACTTTGCT GCCTGAAATT TGTCTATGAT TCTTATAAGT CGGCAAAGTT GCATAGCTAT GCACGATCGA
ACAAAAGTAT AAGAAATGAT GCGTGAAAAG AAAAGGAATT GACTGGTTTG TTGCATAGGT AGTAACTCCA TTTCCCTTTG
CATTTCCCTT TTGTTTTTGC TATCCTTTAG GATGATTACA TCTCTGAAGA AATGGAAGGG TCGGTCGATG GATTGTCTGA
ACAAGTCTCC AGGATGCACT CCTAGTGCAC AACGATGACG ATGATCAGTG CAAGATTCTG TGAGGCGCAC CAGATGCTGA
TAATTTCCAA GCAGAATGCT GCACTGCAAG TTTGGACTTT GGACAATGCA AGTATGCAAC AGCCAGCCCG AGATGATTGG
CATCTTCTTA TGCTCATCCA TGTTCACATA TTCTTCTTGC CATTGTGCTG TCTGTCACTA CAGGACCCCT GCATGGATTA
ATGTATTATC CCTCTGATGT AACACTAGAT TAGTCCATCT GTCCATGGAG GAATGAATAG CAAGCAGCCA GCTTGTGCAT
CATGTGGGCA TGTTCATTTT CCAGTGAGAT CTAGTCATAT CCATGCTTTT TTTGTAATGG TATATGAAAC AGTTTATCAG
TGAGACTCTG GTCCATTCCT CTTTGAAGAA CTGCTGAGAC AGTGATCCAT TCCTCTTTGA AGAACTGTTC ATTTTCAGTA
CATTAAGCCT AGTAAAGTTC AGATGTTTGA GTTCGGTGCT TAATAATCAT GTCACACGAA TTTTC

Locus: Os06g0708000

Loading...

Locus: Os06g0708000

Loading...