Os06t0708000-03

Locus

Os06g0708000

Description

MAP kinase, Plant defense and wounding signaling

RAP-DB Gene Symbol Synonym(s)

BWMK1, OsBWMK1, MPK12, MAPK1, OsMAPK1, OsMPK12, OsMPK17-1, OsBWMK1L, OsBWMK1M, OsBWMK1S

RAP-DB Gene Name Synonym(s)

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1, blast- and wound- inducible MAPK gene-1, Blast- and wound-induced MAP kinase 1, Mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase 1, MAP kinase 17

CGSNL Gene Symbol

BWMK1

CGSNL Gene Name

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1

Oryzabase Gene Symbol Synonym(s)

OsBWMK1, MPK12, MAPK1, OsMAPK1, OsMPK12, OsMPK17-1, MPK17-1, OsBWMK1L, OsBWMK1M, OsBWMK1S, OsMAPK17-1, MAPK17-1, MAPK12, OsMAPK12

Oryzabase Gene Name Synonym(s)

blast- and wound- inducible MAPK gene-1, Blast- and wound-induced MAP kinase 1, Mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase 1, MAP kinase 17

Transcript Evidence

AF194415

Protein Evidence

Q5Z9J0-2

Literature

PMID: 12913152

PMID: 10624015

PMID: 12913152

PMID: 17586462

PMID: 16673940

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

December 17, 2009

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Expression Databases

TENOR (Os06t0708000-03)

Others

Oryzabase (6000)

Transcript

2015 bp

>Os06t0708000-03 MAP kinase, Plant defense and wounding signaling
CCGACCTCGAGGTCGCCGACGACCCGGATCTCGTCGCCCTCCGCTCCATCCGCATCCGCG
TGCCCAAGCGCAAGATGCCTCTCCCCGTCGAGAGCCACAAGAAGAACACAGTGGAAATGG
AGTTCTTCACTGAGTATGGAGAAGCAAGCCAGTACCAGATCCAGGAAGTCATTGGCAAAG
GAAGTTATGGAGTAGTTGCTGCTGCAGTAGATACCCGCACGGGTGAGCGGGTTGCAATCA
AGAAGATCAATGATGTGTTTGAGCATGTATCAGACGCTACGCGCATATTGCGTGAGATCA
AGCTCCTTCGTCTGCTCCGTCACCCAGACATAGTTGAGATCAAACACATTATGCTTCCCC
CTTCTCGAAGGGAGTTCCAAGATATTTATGTTGTTTTTGAGCTCATGGAATCAGATCTCC
ATCAAGTCATCAGAGCGAACGATGACCTCACCCCGGAGCACTACCAGTTTTTCCTGTACC
AACTTCTCCGTGCTCTCAAGTACATCCATGCAGCTAATGTATTTCATCGCGATCTAAAGC
CCAAGAATATACTGGCAAACTCAGACTGCAAATTGAAAATATGTGATTTCGGACTTGCCC
GAGCATCATTCAATGATGCCCCTTCAGCAATATTTTGGACGGATTATGTTGCAACGAGGT
GGTACCGAGCACCTGAATTATGTGGCTCATTTTTCTCCAAATACACTCCTGCAATTGATA
TTTGGAGTATTGGGTGCATATTTGCTGAACTTCTCACTGGGAGACCACTATTTCCTGGGA
AGAATGTTGTGCACCAATTAGATATTATAACAGATCTTCTTGGAACTCCATCATCAGAAA
CCTTATCCAGGATTCGAAATGAGAAGGCCAGGAGATACTTGAGCACCATGCGGAAAAAAC
ATGCTGTCCCCTTCTCTCAGAAGTTCCGCAATACTGACCCCTTGGCTCTTCGTCTGCTAG
AGCGTTTACTGGCATTTGATCCTAAAGATCGGTCTTCAGCTGAAGAAGCTTTGGCTGATC
CGTACTTCGCAAGTCTTGCTAATGTGGAACGTGAGCCCTCAAGACATCCAATCTCAAAAC
TTGAGTTTGAATTCGAGAGACGGAAGCTGACAAAAGATGATGTTAGAGAATTAATTTATC
GAGAGATTTTGGAGTATCACCCACAGATGCTGCAAGAGTATATGAAAGGTGGAGAGCAGA
TTAGCTTCCTCTATCCAAGTGGGGTTGATCGCTTCAAACGACAGTTTGCACACCTTGAGG
AGAACTACAGCAAAGGAGAAAGAGGTTCTCCACTGCAGAGGAAGCATGCTTCTTTACCGA
GGGAGAGAGTAGGTGTATCAAAGGATGGTTATAACCAACAAAACACCAATGACCAAGAGA
GGAGTGCAGATTCCGTTGCCCGCACTACAGTAAGCCCTCCAATGTCACAAGATGCACAAC
AACATGGATCTGCTGGCCAAAATGGTGTGACATCCACAGACTTGAGTTCGAGGAGCTATC
TGAAGAGTGCAAGCATTAGTGCTTCCAAGTGTGTCGCTGTCAAGGACAATAAAGAACCAG
AGGATGATTACATCTCTGAAGAAATGGAAGGGTCGGTCGATGGATTGTCTGAACAAGTCT
CCAGGATGCACTCCTAGTGCACAACGATGACGATGATCAGTGCAAGATTCTGTGAGGCGC
ACCAGATGCTGATAATTTCCAAGCAGAATGCTGCACTGCAAGTTTGGACTTTGGACAATG
CAAGTATGCAACAGCCAGCCCGAGATGATTGGCATCTTCTTATGCTCATCCATGTTCACA
TATTCTTCTTGCCATTGTGCTGTCTGTCACTACAGGACCCCTGCATGGATTAATGTATTA
TCCCTCTGATGTAACACTAGATTAGTCCATCTGTCCATGGAGGAATGAATAGCAAGCAGC
CAGCTTGTGCATCATGTGGGCATGTTCATTTTCCAGTGAGATCTAGTCATATCCATGCTT
TTTTTGTAATGGTATATGAAACAGTTTATCAGTGA

CDS

1521 bp

>Os06t0708000-03 MAP kinase, Plant defense and wounding signaling
ATGGAGTTCTTCACTGAGTATGGAGAAGCAAGCCAGTACCAGATCCAGGAAGTCATTGGC
AAAGGAAGTTATGGAGTAGTTGCTGCTGCAGTAGATACCCGCACGGGTGAGCGGGTTGCA
ATCAAGAAGATCAATGATGTGTTTGAGCATGTATCAGACGCTACGCGCATATTGCGTGAG
ATCAAGCTCCTTCGTCTGCTCCGTCACCCAGACATAGTTGAGATCAAACACATTATGCTT
CCCCCTTCTCGAAGGGAGTTCCAAGATATTTATGTTGTTTTTGAGCTCATGGAATCAGAT
CTCCATCAAGTCATCAGAGCGAACGATGACCTCACCCCGGAGCACTACCAGTTTTTCCTG
TACCAACTTCTCCGTGCTCTCAAGTACATCCATGCAGCTAATGTATTTCATCGCGATCTA
AAGCCCAAGAATATACTGGCAAACTCAGACTGCAAATTGAAAATATGTGATTTCGGACTT
GCCCGAGCATCATTCAATGATGCCCCTTCAGCAATATTTTGGACGGATTATGTTGCAACG
AGGTGGTACCGAGCACCTGAATTATGTGGCTCATTTTTCTCCAAATACACTCCTGCAATT
GATATTTGGAGTATTGGGTGCATATTTGCTGAACTTCTCACTGGGAGACCACTATTTCCT
GGGAAGAATGTTGTGCACCAATTAGATATTATAACAGATCTTCTTGGAACTCCATCATCA
GAAACCTTATCCAGGATTCGAAATGAGAAGGCCAGGAGATACTTGAGCACCATGCGGAAA
AAACATGCTGTCCCCTTCTCTCAGAAGTTCCGCAATACTGACCCCTTGGCTCTTCGTCTG
CTAGAGCGTTTACTGGCATTTGATCCTAAAGATCGGTCTTCAGCTGAAGAAGCTTTGGCT
GATCCGTACTTCGCAAGTCTTGCTAATGTGGAACGTGAGCCCTCAAGACATCCAATCTCA
AAACTTGAGTTTGAATTCGAGAGACGGAAGCTGACAAAAGATGATGTTAGAGAATTAATT
TATCGAGAGATTTTGGAGTATCACCCACAGATGCTGCAAGAGTATATGAAAGGTGGAGAG
CAGATTAGCTTCCTCTATCCAAGTGGGGTTGATCGCTTCAAACGACAGTTTGCACACCTT
GAGGAGAACTACAGCAAAGGAGAAAGAGGTTCTCCACTGCAGAGGAAGCATGCTTCTTTA
CCGAGGGAGAGAGTAGGTGTATCAAAGGATGGTTATAACCAACAAAACACCAATGACCAA
GAGAGGAGTGCAGATTCCGTTGCCCGCACTACAGTAAGCCCTCCAATGTCACAAGATGCA
CAACAACATGGATCTGCTGGCCAAAATGGTGTGACATCCACAGACTTGAGTTCGAGGAGC
TATCTGAAGAGTGCAAGCATTAGTGCTTCCAAGTGTGTCGCTGTCAAGGACAATAAAGAA
CCAGAGGATGATTACATCTCTGAAGAAATGGAAGGGTCGGTCGATGGATTGTCTGAACAA
GTCTCCAGGATGCACTCCTAG

Protein

506 aa

>Os06t0708000-03 MAP kinase, Plant defense and wounding signaling
MEFFTEYGEASQYQIQEVIGKGSYGVVAAAVDTRTGERVAIKKINDVFEHVSDATRILRE
IKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFELMESDLHQVIRANDDLTPEHYQFFL
YQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLARASFNDAPSAIFWTDYVAT
RWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVHQLDIITDLLGTPSS
ETLSRIRNEKARRYLSTMRKKHAVPFSQKFRNTDPLALRLLERLLAFDPKDRSSAEEALA
DPYFASLANVEREPSRHPISKLEFEFERRKLTKDDVRELIYREILEYHPQMLQEYMKGGE
QISFLYPSGVDRFKRQFAHLEENYSKGERGSPLQRKHASLPRERVGVSKDGYNQQNTNDQ
ERSADSVARTTVSPPMSQDAQQHGSAGQNGVTSTDLSSRSYLKSASISASKCVAVKDNKE
PEDDYISEEMEGSVDGLSEQVSRMHS*

5'UTR

chr06:29950247..29950350 (+ strand) : 104 bp

chr06:29951252..29951263 (+ strand) : 12 bp

CDS

chr06:29951264..29951660 (+ strand) : 397 bp

chr06:29951794..29951921 (+ strand) : 128 bp

chr06:29951995..29952054 (+ strand) : 60 bp

chr06:29952402..29952551 (+ strand) : 150 bp

chr06:29952672..29952827 (+ strand) : 156 bp

chr06:29952946..29953083 (+ strand) : 138 bp

chr06:29953171..29953244 (+ strand) : 74 bp

chr06:29953653..29953754 (+ strand) : 102 bp

chr06:29953852..29954092 (+ strand) : 241 bp

chr06:29954279..29954353 (+ strand) : 75 bp

3'UTR

chr06:29954354..29954731 (+ strand) : 378 bp

FASTA

>Os06t0708000-03 class=Sequence position=chr06:29950247..29954731 (+ strand)
CCGACCTCGA GGTCGCCGAC GACCCGGATC TCGTCGCCCT CCGCTCCATC CGCATCCGCG TGCCCAAGCG CAAGATGCCT
CTCCCCGTCG AGAGCCACAA GAAGGTGAGG AGGTGCCTAG TGTGAAGTGT GCTTTGCTTT GCTTCGTTTT CTTTTCAGTT
TGGGGGTGAA ATGAAAGTTT CAGGCTTTCT CGTGATCCTT GATTCGTGGC CACGAGGGGT TCTTAGACTA GATCAGATCT
TCGTGGCACC TGAATTACTT GCATACTGTA CAATATCATT ATTTCTTTTT TTCTATGATC TGTGCAAAGT GCAATACAGC
TCAAGTGCAG GTAAAGCTTG CGTGTTCTAT CCAATCTTTC TTCTTTCGAT GGTTGCTTGT AGAGCGATAG TTGCTTGTAA
ACTGCCATCC GATTCGTCAT CCTGGCTGTT GACCTGTGTT ATTCCAGTGA TCTATGAAAC GATCGATCTC GTAAAACTTA
AGTTTCTTTC TTTCTTTCTC TGTTTGCTTA GTTCTGAAAT TACTTGCTCC TGCATGCTCC ATTTCTTAGA GGAGTGCAAT
TGCAGCACTA CTATGCAAAA AGCTTGTGCC CTCTTTTGGA GCTGTTCTCA ACAATTGGTC CCATCATCCT TGTCATACTG
ATCCTTAGGA GCTCATATCC AAGTTGTCCA CTTGTGGTTT TGGATGATCT CATCAGAATC GGCTACTAAT TAGTACTCCA
GGTTTGACTT GGTCTGGCCT ATGTATATCT CTGGTACGGA CTGTTTCTAT TGGGAACAAG TCGCGTCTTG CACATGGTAT
GGAGCAGGTG TTCCTTTCAT TTGCGAATAA ACCTACATGT CTATGTACTG AAAATGTCAA TTTTTGTTAG GTTGGTCATG
ATATTCCCAG GGACAAGATC ATGGTTTTGT TTATAGGGCT ATTCTACTAC TGAAGAAGTT TTATAACCAG CCACTCTGTA
TTTTTAGTTA GCTTAATATT TTCTTGCAAA ATTGTGATCT TGTAGAACAC AGTGGAAATG GAGTTCTTCA CTGAGTATGG
AGAAGCAAGC CAGTACCAGA TCCAGGAAGT CATTGGCAAA GGAAGTTATG GAGTAGTTGC TGCTGCAGTA GATACCCGCA
CGGGTGAGCG GGTTGCAATC AAGAAGATCA ATGATGTGTT TGAGCATGTA TCAGACGCTA CGCGCATATT GCGTGAGATC
AAGCTCCTTC GTCTGCTCCG TCACCCAGAC ATAGTTGAGA TCAAACACAT TATGCTTCCC CCTTCTCGAA GGGAGTTCCA
AGATATTTAT GTTGTTTTTG AGCTCATGGA ATCAGATCTC CATCAAGTCA TCAGAGCGAA CGATGACCTC ACCCCGGAGC
ACTACCAGTT TTTCCTGTAC CAACTTCTCC GTGCTCTCAA GTACATCCAT GCAGGTAAGC TTAACTACTG ATAATCCCCA
ATTCCCCAAG AACCTACTTG ACCACCATTA AACACATAGT TCTGTTGATT TATCAATTAA CATGGAATTC TAGCTTATTC
TCTGATAAAT CATCTATATT GGCACAGCTA ATGTATTTCA TCGCGATCTA AAGCCCAAGA ATATACTGGC AAACTCAGAC
TGCAAATTGA AAATATGTGA TTTCGGACTT GCCCGAGCAT CATTCAATGA TGCCCCTTCA GCAATATTTT GGACGGTAAG
GTGCTTATAT GAGATTTTAC ATTCCTCTTT AAGTCTTTAT GTTATTAATT ATGTTCTACT TTGTGAAGGA TTATGTTGCA
ACGAGGTGGT ACCGAGCACC TGAATTATGT GGCTCATTTT TCTCCAAAGT AAGGTCTTCA ACACTAGAAT TCTTTCAATC
AAGATTAATG CTTTTGTGGC ACCATAGATG AACTGGTCTA GTTGTTTTTA GCAATGCTTT CTTTTTTTTT TCCTTTTTCT
TTATCTATCC AACTTACAGT TGTGCTAAAT GAAGTATAGA AAATTAAGTT ATTTTTCTTT TTGTTGATAT TTTAGTTGTT
TGTACATACA ATTTTCTATC AAAGCTGCGC CACTTGAAAC TGGATGAGTA ACATTCTTGT AGAGAAACAA TATACTGTGA
ACTCTTTTGT GCAATGCTGA TGCTCTAGCG TTCCATGTGT TTTATGTGTT CTAACAATAG CCAATTTGCA TACAGTACAC
TCCTGCAATT GATATTTGGA GTATTGGGTG CATATTTGCT GAACTTCTCA CTGGGAGACC ACTATTTCCT GGGAAGAATG
TTGTGCACCA ATTAGATATT ATAACAGATC TTCTTGGAAC TCCATCATCA GAAACCTTAT CCAGGGTATG TTTACTTTAT
ACCGATTCTC ATATATCCTT GAACCTCCTA TTCAGTAACA TTCAAGAAGA TCCAATTCTC TAATAAGATG AAACAATCAC
CTTACTGTTT TCTGCGTCTC TGCAGATTCG AAATGAGAAG GCCAGGAGAT ACTTGAGCAC CATGCGGAAA AAACATGCTG
TCCCCTTCTC TCAGAAGTTC CGCAATACTG ACCCCTTGGC TCTTCGTCTG CTAGAGCGTT TACTGGCATT TGATCCTAAA
GATCGGTCTT CAGCTGAAGA AGTAAGCTCA AGAGAAAGCA TAGCATCCTT TCCAAACCTC AAAAGTAGTT TTTTTTTAAA
AAAAAAAACT TTCAGAAAAC ACACATTTTT TATATGTTAT ATTCTCTTCC AATTTTCAGG CTTTGGCTGA TCCGTACTTC
GCAAGTCTTG CTAATGTGGA ACGTGAGCCC TCAAGACATC CAATCTCAAA ACTTGAGTTT GAATTCGAGA GACGGAAGCT
GACAAAAGAT GATGTTAGAG AATTAATTTA TCGAGAGGTA CAAAGCAATA GCTCAAGTTT CCTGCTTTGT GTTAATAATA
AAATTTTCAG CTTTTCAAGA TTGATAATTA TGAAATGCAA ACAGATTTTG GAGTATCACC CACAGATGCT GCAAGAGTAT
ATGAAAGGTG GAGAGCAGAT TAGCTTCCTC TATCCAAGGT GGAGTCTTGC ATTAATTTTT CTTTCTTTCA TCAGTTTTAA
ATTTGACGTG ACAAAGATGA ATATCTGGCT TTGTTCCAGC AAGTTAGCAT GGTGTACAAT ATACTTCTTT GCACCAACAA
AATTGCCTTC GCCAAATACT CTTGTTGGCA AAGCAAATTT ACTAAGTATA GTAGTAATTT GCTTTGCAGT GCTATCATGA
GTTAATATCT GATCTATTCT TGTTGCTCTC ATTTTGGTAT ATCTTTATTT CCAAGGCTCC TTTCACCCGA AAATTGCATG
GACATTGTTA CAGGAAACAC TAGCCATGTG TGCATCTAAT ATATATTTAT CATGTCCTTG CATGGTTTTC TCTCCTTTTT
TTACCGTGAA CATAGCTATT CTGTTAATAT TGTTATCTTA CTGCAGTGGG GTTGATCGCT TCAAACGACA GTTTGCACAC
CTTGAGGAGA ACTACAGCAA AGGAGAAAGA GGTTCTCCAC TGCAGAGGAA GCATGCTTCT TTACCGAGGT ACATAATGTG
GCAATATCAG AAATCAAAAG TGCAGACCTA CTTACTTTCA TATCAATTAT TGTACTAACT TCTCCATTGA TTTTGCATAT
AACAGGGAGA GAGTAGGTGT ATCAAAGGAT GGTTATAACC AACAAAACAC CAATGACCAA GAGAGGAGTG CAGATTCCGT
TGCCCGCACT ACAGTAAGCC CTCCAATGTC ACAAGATGCA CAACAACATG GATCTGCTGG CCAAAATGGT GTGACATCCA
CAGACTTGAG TTCGAGGAGC TATCTGAAGA GTGCAAGCAT TAGTGCTTCC AAGTGTGTCG CTGTCAAGGA CAATAAAGAA
CCAGAGGTAC TGTTACTTTG CTGCCTGAAA TTTGTCTATG ATTCTTATAA GTCGGCAAAG TTGCATAGCT ATGCACGATC
GAACAAAAGT ATAAGAAATG ATGCGTGAAA AGAAAAGGAA TTGACTGGTT TGTTGCATAG GTAGTAACTC CATTTCCCTT
TGCATTTCCC TTTTGTTTTT GCTATCCTTT AGGATGATTA CATCTCTGAA GAAATGGAAG GGTCGGTCGA TGGATTGTCT
GAACAAGTCT CCAGGATGCA CTCCTAGTGC ACAACGATGA CGATGATCAG TGCAAGATTC TGTGAGGCGC ACCAGATGCT
GATAATTTCC AAGCAGAATG CTGCACTGCA AGTTTGGACT TTGGACAATG CAAGTATGCA ACAGCCAGCC CGAGATGATT
GGCATCTTCT TATGCTCATC CATGTTCACA TATTCTTCTT GCCATTGTGC TGTCTGTCAC TACAGGACCC CTGCATGGAT
TAATGTATTA TCCCTCTGAT GTAACACTAG ATTAGTCCAT CTGTCCATGG AGGAATGAAT AGCAAGCAGC CAGCTTGTGC
ATCATGTGGG CATGTTCATT TTCCAGTGAG ATCTAGTCAT ATCCATGCTT TTTTTGTAAT GGTATATGAA ACAGTTTATC
AGTGA

Locus: Os06g0708000

Loading...

Locus: Os06g0708000

Loading...